SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000140 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000140
Domain Number 1 Region: 1763-1884
Classification Level Classification E-value
Superfamily Bromodomain 6.8e-36
Family Bromodomain 0.00021
Further Details:      
 
Domain Number 2 Region: 542-656
Classification Level Classification E-value
Superfamily DNA-binding domain 2.91e-22
Family Methyl-CpG-binding domain, MBD 0.013
Further Details:      
 
Domain Number 3 Region: 1648-1712
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.09e-18
Family PHD domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000140   Gene: ENSSHAG00000000118   Transcript: ENSSHAT00000000143
Sequence length 1890
Comment pep:known_by_projection scaffold:DEVIL7.0:GL862059.1:21:20881:-1 gene:ENSSHAG00000000118 transcript:ENSSHAT00000000143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEMEANDHFNFTGLPPAPAASGLKPSPPSGEGLYTNGSPMNFSQQGKSLNGDVNVNGLST
VSHTTSGILNSAPHSSGTSHLHHPNVAYDCLWNYPQYPPANTGSNLKDPPLLSQFSGHRQ
YPLNGTIGGSRQGSPPSQNTNLRAGNQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMS
NGPSSFFTSSPPSPMLGSSVQTFAPSQDPEHGGHPSEAADKELAPIVAENGTGLVGSLEL
EGEQPELKLCDYDSSAPSVESLRREVSVLVPDPTVSCLDDPSQLPEQLEGSSILGEDPLE
PFDSLAPAEPGSGGLYGMDDSELVGEEDKLPLGDSPDISALECPSLTNSAAFSLLADDSQ
TSTSIFANPPSPPVLGESVLQDGSFELNNGSDPEQEEVETSVTAASPGLAPSAPAELSPE
ETDTDGSSGPGCTPDLEEQLAGGDAASSSGEQVEAHHASPPLALAASPGTGNSPFSPARL
VSCLPLLPSMLWSALHHPAPREPFLVTESAFMAQPCPPRPLLSYQLPPLGSRPLFSSGDV
LRRRIATPEEVRFPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRNV
VHHVRREHFSFSPRMPVGDFYEERDTPEGLKWVQLSVEEIPSRIEAITGKRGRPRNTEKT
KVKEMPKIKRGRGRPPKVKITELLSKTDARFLKRLEASDAPSDGEKAKMSKIKKKIRRKV
YFREAPTSIKHNLQAKNQRKQEAKSSKQKEIKKKSKTEKEKVKAKTDKLKVRKEKIRPKE
KEESRPVLKAERVSAPQRRLEERERQQMILEEMKKPTEDMCLADHQPLPDFSRIPGLVLP
SSAFSDCLTIVEFLHSFGKVLGLDPAKDVPSLGALQEGLLCQGEALDEVQDLLVKLLQAA
LCDPGLPAYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGAEPAVCDSLRTKPFQAQT
PQQKAAVLAFLVHELNGSNIIISEIDKTLENMSSYRRNKWIVEGRLRRLKTALAKRTGRS
EAELLGLEESLGRRRSSRIPEETSGMEEEEEEDTAQGRWGRRDEEGDALPFSIPELERQI
EKLTKRQLFFRKKLLQSSQMLRAVSLGQDRYKRRYWVLPYLSGIFVEGAEETTALEDVIK
QEADSSKGVAVPAPSITSFSTVKKELTEGNVKTWSPCVRARGRPRKTKPVPEQPEISVLP
LVKEEHKFVQAQVQEQAQEQEQTQTQVLNGLLEPEDSPMSLGQSQHDLSQSAFLSWLSQT
QSHGSLLSSSVLTPDSSPGKLEPGPAMYPEEPETSQPDLPPPRGPWFNLLPRTPCDAAPS
TSPCASEDGPSPDPPTPPASSQPVNGPSAAKPCSPKPFSSTPLSMSAPKRWAGVSGKGTR
SPAGPGQPKRRGRPPSKFFKQMEQRYLTQLTAQPVPAEMRRGWWWIRDPEELEATLRALH
PRGIREKALHKHLSKHRDFLKEVCLRPPTDPILKPSRCPTVSQKELVCWSPAERAFEADL
VMLQCVEELERRVLLADLQIRGWTCPSLDSAREDLAYYEHLPEPLEDITARGRGREGLVP
QREDTNPLDLAVLRLAALEQNVERRYLREPLWPAHEVVLEKALLSPPDSTALGTTEIAYE
ITPRVRTWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVTCLVCRKGDNDEFLLLCDG
CDRGCHIYCHRPKMDTVPEGDWFCAVCLAQQAEGEFPQKPGFPKRGQKRKGGPLGFSEPE
SRRRRRPRAVSRGQDAAAVSRCSGEGLSSSKRRRLSMRHHHSDLTFCEIILMEMESHDSA
WPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYSNSEEFAADALLVFDNCQTFNED
DSEVGKAGHIMRRFFESRWEEFYQGKQANL
Download sequence
Identical sequences G3VAD6
ENSSHAP00000000140 ENSSHAP00000000140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]