SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000155 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000155
Domain Number 1 Region: 54-162
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.00062
Further Details:      
 
Domain Number 2 Region: 236-339
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 5.12e-20
Family Platelet-derived growth factor-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000155   Gene: ENSSHAG00000000129   Transcript: ENSSHAT00000000158
Sequence length 345
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864813.1:21:221625:1 gene:ENSSHAG00000000129 transcript:ENSSHAT00000000158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLIGVLLLTSALASQRYGAQAESNLSSKFQFSSNKEQNGVQDPQHERIITVTTNGSIHS
PKFPHTYPRNTVLVWRLVTEEENMWIQLTFDERFGLEDPEDDICKYDFVEIEEPSDGTIL
GRWCGSSAVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYTLLTPHHTEAISPSVLPPSA
LPLDLLNNAIAAFSTLEELIRYLEPDRWQLDLEDLYRPTWQLLGKAYVLGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSLREELKRTDTIFWPGCLLVKRCGGNCACCQHNCNECQCIPSK
VTKKYHEVLQLKPRIGVRGLHKSLTDVLLEHHEECDCVCKGNTEG
Download sequence
Identical sequences G3VAF1
ENSSHAP00000000155 XP_003773161.1.9362 ENSSHAP00000000155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]