SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000187 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000187
Domain Number 1 Region: 119-212
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-21
Family PDZ domain 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000187   Gene: ENSSHAG00000000157   Transcript: ENSSHAT00000000190
Sequence length 774
Comment pep:known_by_projection scaffold:DEVIL7.0:GL867583.1:25:32080:-1 gene:ENSSHAG00000000157 transcript:ENSSHAT00000000190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCNMCVVQKPEEQYKVMLQVNGKEQTLEALRSSKEPLVIQVLRRSPRLRGDSSCNDLQL
VDSGTQTDITFEHVMALGKLRPPTPPMVILEPPPIGHEYYDPAEFMEGSQQEADRVDELE
YEEVELYKASHQDKLGLMVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQINGM
DVQNREEAVAILTQEENTNISLLVARPEMELTKRWKDSDREDFLDDFGSENEGELPVQKL
KSPSAYQLENEDGKGTSGPGPGLNNSQELDSGVGRTDESTRNEESSEHDLLGDEAPSTTN
TPGSLRKFGLQGDALQSRDFHFSMDSLLAEGAGLGGGDVPGLTDEEYERYRELLEIKCHL
ENGNQLGLFFPRAGGGNSSLDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQKMQQLRE
RCMKAWLLEEESLYDFGASEPKKHELSDITELPEKSDKDSTSAYNTGESCRSTPLLMEPL
LESPLRRVTDTIFKAACLGAEKAAPGNSNLNQTIAGPHKAGPPDGSPAKFRSLSRDGEVC
QRQHADDRLRRSPKAGGTLEQVGAEGSPYLSRRHRVQGQASERYHSCVQLSQARGLEELS
HNPLSLASMCKDSLASPKVGGAEAPRMEWKVKVRSDGTRYVAKRPVRDRLLKARALKIRE
ERSGMTTDDDAVSEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLKEQQNSESK
HELNIIALSHRKTMKKRNKKILDNWITIQEMLAHGTRSADGKRVYNPLLSVTTV
Download sequence
Identical sequences G3VAI3
ENSSHAP00000000187 ENSSHAP00000000187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]