SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000188 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000188
Domain Number 1 Region: 102-195
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-21
Family PDZ domain 0.0000701
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000188   Gene: ENSSHAG00000000157   Transcript: ENSSHAT00000000191
Sequence length 742
Comment pep:known_by_projection scaffold:DEVIL7.0:GL867583.1:781:7900:-1 gene:ENSSHAG00000000157 transcript:ENSSHAT00000000191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEQTLEALRSSKEPLVIQVLRRSPRLRGDSSCNDLQLVDSGTQTDITFEHVMALGKLRPP
TPPMVILEPYVLSELPPIGHEYYDPAEFMEGSQQEADRVDELEYEEVELYKASHQDKLGL
MVCYRTDDEEDLGIYVGEVNPNSIAAKDGRIREGDRIIQINGMDVQNREEAVAILTQEEN
TNISLLVARPEMELTKRWKDSDREDFLDDFGSENEGELPVQKLKSPSAYQLENEDGKGTS
GPGPGLNNSQELDSGVGRTDESTRNEESSEHDLLGDEAPSTTNTPGSLRKFGLQGDALQS
RDFHFSMDSLLAEGAGLGGGDVPGLTDEEYERYRELLEIKCHLENGNQLGLFFPRAGGGN
SSLDVNRNESLGHEMAMLEEELRHLEFKCRNILRAQKMQQLRERCMKAWLLEEESLYDFG
ASEPKKHELSDITELPEKSDKDSTSAYNTGESCRSTPLLMEPLLESPLRRAAPGNSNLNQ
TIAGPHKAGPPDGSPAKFRSLSRDGEVCQRQHADDRLRRSPKAGGTLEQVGAEGSPYLSR
RHRVQGQASERYHSCVQLSQARGLEELSHNPLSLASMCKDSLASPKVGGAEAPRMEWKVK
VRSDGTRYVAKRPVRDRLLKARALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQHLIR
AREQRKRREFMMQSRLECLKEQQNSESKHELNIIALSHRKTMKKRNKKILDNWITIQEML
AHGTRSADGKRVYNPLLSVTTV
Download sequence
Identical sequences G3VAI4
ENSSHAP00000000188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]