SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000329 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000329
Domain Number 1 Region: 396-611
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-29
Family Kelch motif 0.021
Further Details:      
 
Domain Number 2 Region: 103-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 3 Region: 924-974
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 55-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000329   Gene: ENSSHAG00000000291   Transcript: ENSSHAT00000000334
Sequence length 1197
Comment pep:known_by_projection scaffold:DEVIL7.0:GL850723.1:339:15761:1 gene:ENSSHAG00000000291 transcript:ENSSHAT00000000334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGVTHCNQTCLEDCGHGTCSGPPDFTCVCDLGWTSDPPLPTPAPGPPAPLCSRDCGCNFH
SSCSSQGPGICDACQDWTWGERCEQCRPGSFGNATGPGGCQPCQCNGHGDPLQGHCDGHT
GLCFCQDHTEGAHCELCAAGYYGDPRAGGSCFRECGGRALLTNVSSVALGSRRAGGPPQA
GGQAGPGLAYCVWVVSASETLEPCPPGAPCPPLTLTFSPDSSTPCTLSYVLAFDGFPRFL
DTGVVQSDRSLIAAFCGQRRDRPLTVQALSGLLVLHWEANGSSSWGFNASVGSGRCEMGP
GGPGSCPAPQECVPEEAGGAGVGRCRCPPGWAGPACTLALCPGNCSAHIAGGICNQSLGL
CVCFEGFGGADCATHLDGGRLVWETLLDSRLSADTASRFLHRLGHTMVEGPDSTLWMFGG
LGLPQGLLGNLYRCSVGERRWTQMLAGSEDGGPGPAPRSFHAAAYVPAGRGAMYLLGGLT
XAGVARDFWVLNLTTLQWRQTPQALLLPAVAGHTLTSRRGLSLLLVGGYSPENGFNQQLL
EYQLTTGTWLASPSSGTPPTGLYGHSAVYHEATDSLYVFGGFRFHVELAAPSPELYSLHC
PDRTWSLLAPSQGAKAAPPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSE
AACGAADCEQCTQEGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVSPMPVESSP
PMPCPTPCHRLPNCSSCLDSKGADGGWQHCVWSSSLQQCLSPSFLPLRCLAGGCGRLLRG
AESCSLGCGNAPQCALCLRRPHCGWCARGDPGQDGAGLCMEGGLSGPRNGLTCGHGDPGA
TWAFLSCPPENECVNGHHDCNETQNCHDRPHGYECTCKTGYTMDHVRGQCRPVCAQGCVN
GSCVEPDHCLCHFGFVGRNCSTECRCNRHSNCDGVGARDRCLECHNNTAGPHCERCRPLF
VGSALGGGTCRPCRAFCRGNSDICVSEKELEMARDDPETYSLDPEEIEKWVSEGPSEDEA
VCVNCQNNSYGDKCQRCLEGYFLLDGRCTKCQCNGHADTCNEDGTGCPCQNNTETGTCQG
SSPNDRRDCYKYQCAKCRESFHGSPLGGQQCYRLISVEQECCLDPTSQTNCFHEPKRRAL
GPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVDPDTGVHSVHIQ
Download sequence
Identical sequences G3VAX5
ENSSHAP00000000329 ENSSHAP00000000329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]