SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000871 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000871
Domain Number 1 Region: 131-228
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-23
Family I set domains 0.0068
Further Details:      
 
Domain Number 2 Region: 27-125
Classification Level Classification E-value
Superfamily Immunoglobulin 4.36e-20
Family I set domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000871   Gene: ENSSHAG00000000779   Transcript: ENSSHAT00000000882
Sequence length 228
Comment pep:novel scaffold:DEVIL7.0:GL853232.1:4332:5784:1 gene:ENSSHAG00000000779 transcript:ENSSHAT00000000882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPRIMEVFCTQIVLKRESTSFSSGKLPRPTLWAQPGLAVAPGTNITLWCSRPPLAYPEE
VTYTLWKTGTWQPLQNQDSADLWTDFSLPSVRREDTGSYRCTYKDRTASDEESESSEALE
LVVTGELSGSLPKPSLSALPGLVVAPGQHVTLQCRKPPRSALWRATFTLLKVGSPQPLQS
QNTSGTSAYFPLLSVRAQDSGNYTCVYSERMAPYQVSEPSDALEIWVT
Download sequence
Identical sequences G3VCG7
ENSSHAP00000000871

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]