SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000970 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000970
Domain Number 1 Region: 102-345
Classification Level Classification E-value
Superfamily vWA-like 1.87e-76
Family Integrin A (or I) domain 0.000000571
Further Details:      
 
Domain Number 2 Region: 346-432
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-20
Family Integrin domains 0.002
Further Details:      
 
Domain Number 3 Region: 3-61
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000188
Family Plexin repeat 0.00088
Further Details:      
 
Domain Number 4 Region: 550-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000446
Family Integrin beta EGF-like domains 0.0072
Further Details:      
 
Domain Number 5 Region: 506-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family Integrin beta EGF-like domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000970   Gene: ENSSHAG00000000868   Transcript: ENSSHAT00000000982
Sequence length 726
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861709.1:4354:79460:-1 gene:ENSSHAG00000000868 transcript:ENSSHAT00000000982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEENRCTSSNAATCTKCLGLGPECGWCAQEDFMAGAAASERCDIVSNLVSKGCLSDFIES
PSVAVTIPTGGEVNTQVSPREVLIQLRPGAEASFMLKIHPLQKYPVDLYYLVDVSASMHN
NIEKLNSVGNDLSQKMAPFSHDFRLGFGSYVDKTVSPYISIHPGRIHNQCSDYNLDCMPP
HGYIHVLSLTENITEFERAVDRQKISGNIDTPEGGFDAMLQAAVCQSHIGWRKEAKRLLL
VMTDQTSHLALDSKLAGIVVPNDGKCHLKDNVYVKSTTMEHPSLGQLAEKLIDNNINVIF
AVQGKQFHWYKDLLPLLPGTVAGQIESKAANLNNLVVDAYQKLISEVRVQVENQIQGVHF
TITAICPDGSRHTGMEGCRNVTSSDEVLFNITVTMDRCDRAGGRDYAIIRPIGFNESTKV
HIYRNCSCQCDDGRSPKQKCVDESLLEPTCPQCDGDKCQFDEDKSPLDSCKAQKNQPICS
GQGVCICGKCFCHKTKLGKVYGKYCEMDDFSCPYHHGNLCAGHGECEGGRCKCFHGWEGD
RCQCPSSSAQHCVNSKGQVCSGRGTCVCGKCECTDPRIVGRFCEYCPTCDTACDENRNCV
QCHHPHNLSQAILDQCRGSCPPRAHYIGQIEECFSSPSHFRIFFIIFIITFLIGLLKVLI
IRQIILQRTRNKVKSASYRVSTSKKKDKMFLPAVCTHTVTYRRDKPDEINIDISKLHPHE
TFKCNF
Download sequence
Identical sequences G3VCR6
ENSSHAP00000000970 ENSSHAP00000000970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]