SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000000977 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000000977
Domain Number 1 Region: 19-292
Classification Level Classification E-value
Superfamily YWTD domain 2.62e-45
Family YWTD domain 0.00000506
Further Details:      
 
Domain Number 2 Region: 345-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000203
Family EGF-type module 0.035
Further Details:      
 
Domain Number 3 Region: 419-453
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000451
Family EGF-type module 0.021
Further Details:      
 
Domain Number 4 Region: 381-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000132
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000000977   Gene: ENSSHAG00000000875   Transcript: ENSSHAT00000000990
Sequence length 690
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861726.1:4433:14539:1 gene:ENSSHAG00000000875 transcript:ENSSHAT00000000990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVHNTCKAEGSEYQVLYIADDNEIRSLFPGHPNSAYEQAFQGDESVRIDAMDVHVKAGR
VYWTNWHTGTISFRSLPPTAPPTTSNRHRRQTEGGVTHLNISGLKMPRGIAIDWVAGNIY
WTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHPKIETAAMDG
TLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSIIGSIRLNGTDPVLAADSKRGLSHPF
SIDVFEDYIYGVTYINNRVFKIHKFGHSPLINLTGGLSHASDVVLYHQHKQPEVTNPCDR
KKCEWLCLLSPSGPVCTCPNGKRLDNGTCVLLPSPTPPPDAPRPGTCSLQCLNGGSCFLN
ARRQPKCRCQPRYTGDKCELDQCWQYCQNGGTCAASPSGMPTCRCPTGFTGPTCNQQVCA
GYCTNNGTCSVNQGNQPQCRCPPGFLGDRCQFKKCFDYCENQGVCQMASDGTKLCRCTSQ
FEGPQCQVDKCSRCLDGSCSILRQSGEVTCNCSDGRIAPSCLTCDGHCFNGGSCTMNSKQ
MPECQCLSPNTGPRCEQSVSQSQPGRIASILIPLLLLLLLLLVAGTVFWYKHRIRGAKGF
QHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTNPVYATLYMGG
HGSRHSLASTDEKRELLGRGLEDELGDPLA
Download sequence
Identical sequences G3VCS3
ENSSHAP00000000977 ENSSHAP00000000977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]