SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001001 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001001
Domain Number 1 Region: 11-132
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-29
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 2 Region: 148-212
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.2e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001001   Gene: ENSSHAG00000000896   Transcript: ENSSHAT00000001014
Sequence length 249
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841367.1:4627:5376:1 gene:ENSSHAG00000000896 transcript:ENSSHAT00000001014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDRLANSEANTRRISIVENCFGAAGQPLTIPGRVLIGEGVLTKLCRKKPKARQFFLFND
ILVYGNIVIQKKKYNKQHIIPLENVTIDSIKDEGDLRNGWLIKTPTKSFAVYAATATEKS
EWMNHINKCVTDLLSKSGKTPSNEHAAVWVPDSEATVCMRCQKAKFTPVNRRHHCRKCGF
VVCGPCSEKRFLLPSQSSKPVRICDFCFDLLSSGDLATCQPTRSDSYSQSTKSPLNNVSD
DEDDEDSSD
Download sequence
Identical sequences G3VCU7
ENSSHAP00000001001 ENSSHAP00000001001 XP_003760310.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]