SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001017 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001017
Domain Number 1 Region: 992-1107
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.71e-20
Family Regulator of G-protein signaling, RGS 0.0029
Further Details:      
 
Domain Number 2 Region: 630-752
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000000000000236
Family Regulator of G-protein signaling, RGS 0.0027
Further Details:      
 
Domain Number 3 Region: 821-948
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000053
Family Regulator of G-protein signaling, RGS 0.0058
Further Details:      
 
Domain Number 4 Region: 360-481
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000014
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001017   Gene: ENSSHAG00000000912   Transcript: ENSSHAT00000001030
Sequence length 1202
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841374.1:4757:132164:-1 gene:ENSSHAG00000000912 transcript:ENSSHAT00000001030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FKTFLFQTFSEAIRFNVDYGVFEVLNDAPNILEKQLKRILREQKPRNPIYDVIRKEKCDI
IPNKPISPTKQSTVKINYNIMSLNREQSIQWIKKERLPAFLESDCYFEYRLAKLISQVRW
SRSGMKMHIDSLYRPWVTKKLEAPPPSIAEDENELLMKKYYISLGEATFTQTQDWFTMAK
QSQATVTTFSSPTSIISSRIQEKAFEGLESETSVMEKGNRNRVKNEPMKKDSSIDPGSSS
ETLNEKGFLSVKDSPSHALLRIYLERQEVSQDLELFFTTFEEFITAYINFIMKSALAKLV
QRPLKEEVINFNNVSQVVIQAPKENVERKISHFSVDIKKNEFDENVELVSLCSRTESIGV
DARADWCLSHKTYDIGTRKEFERFKKFIKGTLGERYRWLWMDIERLKVLRDAGRRQRHLE
KMRKCYLVSTGECYLTPEVLIKLNLIDGSFWNEPHLRCIQADVVKPLLQYWGPRFCVTHK
YEIKNASAELKFWHSRQEQPRKDIDPFPQMVTLLPLRPKSCMPQISTLKKEDFIQLRSLK
SARKSLKKSERAGSATFRKSSGKSEAPDEIAEQELTGKSSKCMTISSKVIRLTSFTDISE
CLKPQLDRKFSYTEETTVKKAPADAALFGSEMENLLQSLFVENRAGYFFTKFCERSENKL
WKNSAYFWFDLQAYHQLFYQETLQPFKVCKQAQYLYAMYVAPSATLDIGLEKKKKKEIYM
KIDPPFEDLFDAAEEYILLLLLEPFKEMVKSDQINYGQVELLQQNRQLDSWYLRKLQAMH
RESTPKTEEDRSLPYGKGDLPLPYIPKETQLWNKVPKEFRHLNFNYLLTNKLEFEHFRQF
LASHSASMDLMCWTDIEQFRRILHQDKKQREAKSIEIKNKYLNKKYFFGPNSPATKEQQD
EIMQLGGGWGMILHDQLASPVLLEIQKCVQRRLENMWLPLFLSCEQFAARQKIKLQMEDI
AEEFILKKRGEKIGVWKPEESKWISSSTDIIAFRKALLNPLLAKLFQQFVSLKGELLGNG
VLFWQEVQKYKDLCHSHCEDAVIQNKITTIINCFINSSVPPALQIDLPFDQAQKIIEHRK
ELGPYVFREAQMTIFGVLFKYWPEFCQFQSNLTDEKVMSTLERRKEFKKKQATSIEDSKT
KLQDASRTASGSVSGSGRISSTTGLNMQAYNRQPSWCYSKYIEALEQERTLLKIQEDLEK
KI
Download sequence
Identical sequences G3VCW3
ENSSHAP00000001017 ENSSHAP00000001017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]