SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001083 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001083
Domain Number 1 Region: 534-644
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 2 Region: 377-486
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-36
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 696-801
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.15e-36
Family Spermadhesin, CUB domain 0.00018
Further Details:      
 
Domain Number 4 Region: 268-377
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-35
Family Spermadhesin, CUB domain 0.00049
Further Details:      
 
Domain Number 5 Region: 825-918
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-28
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 6 Region: 642-686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000116
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 7 Region: 488-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000363
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 8 Region: 65-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000122
Family Astacin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001083   Gene: ENSSHAG00000000970   Transcript: ENSSHAT00000001097
Sequence length 929
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834453.1:5324:82261:1 gene:ENSSHAG00000000970 transcript:ENSSHAT00000001097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGGLGEQSYEIEPNATAPSHSTKKVKKGGRQNSMLSRRLKKKGPKASLAGPVESSSRVRR
ATTSRTERIWPGGVIPYVIGGNFTGQLFALFSPSINFPLNHVITTLIETYSASTYIGFNI
YWITCYLGEEVGKRGGQKSQVSTQKLYCTKYDGRVVLVGTWHLSCSPDLLKTHARVIFYN
IIPCTHFCSNFSPPSLHPFPQMGELDLEGINNPGRRTKMREGVFLDTILPRRDDNGIRPT
IGQRVRLSQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGE
KIILNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKVPEPLISTDSRLWVEFRS
SSNILGKGFFAVYEAICGGEIHKDSGQIQSPNYPDDYRPSKECVWKITVSEGFHVGLTFQ
AFEIERHDSCAYDYLEIRDGATEESALIGHFCGYEKPDDIKSSSNKMWMKFVSDGSINKA
GFAANFFKEVDECSWPDRNGCEQRCVNTLGSFKCACDPGYELAADKKTCEAVACGGFMTK
LNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDICKYDYVEIRSGLSS
DSKLHGKFCGSEKPEVITSQSNNMRVEFKSDNTVSKRGFKAHFFSDKDECSKDNGGCQHE
CINTFGSYVCQCRNGFVLHENGHDCKEAGCEHRVNSAEGIMASPNWPDKYPSRKECTWNI
SSTPGHRVKITFNEFEIEQHQECAYDHLELYDGSNSKSPMLGRFCGSKKPDPVVASTNRM
FLRFYSDASVQRKGFQARHSTECGGRLKAEVQTKDLYSHAQFGDNNYSGQSHCDWVIAAE
DGYGVELIFQTFEVEEEADCGYDYMEAFDGYDSTAPRLGRFCGSGPLEEIYSAGDSLMIR
FHTDDTINKKGFHARYTSTKFQDALHMRK
Download sequence
Identical sequences G3VD29
ENSSHAP00000001083 ENSSHAP00000001083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]