SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001156 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001156
Domain Number 1 Region: 101-166
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.33e-16
Family PHD domain 0.013
Further Details:      
 
Domain Number 2 Region: 46-95
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000399
Family Tudor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001156   Gene: ENSSHAG00000001031   Transcript: ENSSHAT00000001171
Sequence length 211
Comment pep:known_by_projection scaffold:DEVIL7.0:GL858348.1:6178:11392:1 gene:ENSSHAG00000001031 transcript:ENSSHAT00000001171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRDSTGACNSLVHKRSPLRRNQKTPTSLTKLSLQDGQKAKKPACKFEEGQDVLARWSDGL
FYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMV
ICDKCGQGYHQLCHTPNIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQ
TLPYSVADLEWDPGHKTNAQQCYCYCGGPGE
Download sequence
Identical sequences G3VDA2
ENSSHAP00000001156 ENSSHAP00000001156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]