SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001163 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001163
Domain Number 1 Region: 88-148,268-351
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.45e-33
Family Regulator of G-protein signaling, RGS 0.0063
Further Details:      
 
Domain Number 2 Region: 347-485
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.74e-28
Family Regulator of G-protein signaling, RGS 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001163   Gene: ENSSHAG00000001038   Transcript: ENSSHAT00000001178
Sequence length 601
Comment pep:known_by_projection scaffold:DEVIL7.0:GL857008.1:6243:38487:1 gene:ENSSHAG00000001038 transcript:ENSSHAT00000001178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFFLTVKGKEQDKATDVKAIKAALPVHSPQKSPRNHALLEAAGPSHVAINAISANMDSFS
SSRTATLKKQPSHMEAAHFGDLGRSCLDYQTQETKSSLSKTLEQVLQDSIALPYFIQFME
LRRMEHLVKFWLEAESFRSTTWSRIRAHSLNTVKQSSLAEPLSPSSKRHETTVSFPSQFL
DQRLESSSTVQLLMTHSKGTEMNNRTSNAQNHSLPSQDRDNVRSLHLEMSKEVTQVSMEY
QDSSRLMGSNRNSPSSTLKELSGKLMRSIERDAVSTFTKYISPDAAKPIPITEGMRNDIV
AKICGEDGQVDPNCFIMAQSIVFHAMEQEHFSEFLRSHHFCKYQIEVLTSGTVYLADILF
CESALFYFSEYMEKEDAVNILQFWLAADNFQSQLAAKKGQYDGQEAQNDAMILYDKYFSL
QATHPLGFDDFVRLEIESNICREGGPLPSCFTTPLRQAWTTMEKVFLPGFLSSNLYYKYL
NDLIHSVRGDEFPGGNIALTIAGSGGPPDQETHSSSDSSTQFNVKKANVKILKNFDEAII
VDAASLDPESLYQRTYAGKMTFGRVSDLGQFIRESEPEPDVKKSRGLWYSLHLTESSFVI
V
Download sequence
Identical sequences G3VDA9
ENSSHAP00000001163 ENSSHAP00000001163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]