SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001227 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001227
Domain Number 1 Region: 187-286
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000267
Family Growth factor receptor domain 0.028
Further Details:      
 
Domain Number 2 Region: 117-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000131
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001227   Gene: ENSSHAG00000001094   Transcript: ENSSHAT00000001242
Sequence length 436
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864759.1:6826:91235:-1 gene:ENSSHAG00000001094 transcript:ENSSHAT00000001242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLGLVIASAFYPEAAAEFDGRWPRQIVSSIGLCRYGSRIDCCWGWARQSWGQCHPVC
QPRCKHGECIGPNKCRCHPGYSGKTCNQDDHPYPTPLDQHSEQPNVHLLDLHAMNLPSRD
LNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGSCSSALSCSMANCQYGCDVMKGDV
RCRCPSPGLQLGPDGRTCVDVDECATGRASCPRFRQCVNTFGSYICKCHKGFDLMYIGGK
YQCHDIDECSLGQYQCSSFARCYNVHGSYKCKCRDGYRGDGINCIYIPKVMIEPSGPIHI
SKGNSTFPKGNGGHINTIPDIASTRWPPRTPHIPIIHTERSTPKPLRPTLKPTTQPPPTT
TELITVRMTPPPPPPAVATQRPTLKPSTMAPSFSTKIPIESTSSREMMVDNRIPVDPQKP
RGDVFSIFLENVFSRV
Download sequence
Identical sequences G3VDH3
ENSSHAP00000001227 ENSSHAP00000001227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]