SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001296 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001296
Domain Number 1 Region: 112-198
Classification Level Classification E-value
Superfamily PDZ domain-like 2.1e-21
Family PDZ domain 0.0000213
Further Details:      
 
Domain Number 2 Region: 6-100
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-20
Family PDZ domain 0.00000852
Further Details:      
 
Domain Number 3 Region: 433-528
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-17
Family PDZ domain 0.00000937
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001296   Gene: ENSSHAG00000001158   Transcript: ENSSHAT00000001312
Sequence length 571
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861565.1:7891:99951:1 gene:ENSSHAG00000001158 transcript:ENSSHAT00000001312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLITESVIPSSGTFHVKLPKKHSVELGITISSPASRKPGDPLVISDIKRGSVAHRTGTLE
LGDKLLAIDNIRLDNCSMEDAVQILQQCEDLVKLKIRKDEDNSDEQESSGAIIYTVELKR
YGGPLGITISGTEEPFDPIIISSLTKGGLAERTGAIHIGDRILAINSSSLKGKPLSEAIH
LLQMAGETVTLKIKKQTDVHSASSPKKFPVPSHLSELSDVEDETSTPQKPGKHSDIYCAT
APSVDSAVESWDSSGMDTSYGSQGPGLQASGSNFNAFEWRNPKQRSGLSPTSKTLNQEVD
LSDYEWERPTTSGFPGTHNNVDGEQEENFWSQALEDLETCGQSGILRELEEKADRRLCLR
NMTLLATIMLGSTLSLNHEASAPSRSQLGRQASFQERSTSRSHYSPATRSNTLPIDMGRK
SLPTRKIKQEIKEIMSPTPVELHKVTLYKDCDMEDFGFSVSDGLLEKGVYVKNIRPTGPG
DLGGLKPYDRLLQVNHVRTRDFDCCLVVPLIAESGNKLDLVISRNPLASQKVVSDQQRTL
PGGEWGDQNRAFFQQTGHGGSLETREPTNTL
Download sequence
Identical sequences G3VDP2
ENSSHAP00000001296 ENSSHAP00000001296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]