SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001367 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001367
Domain Number 1 Region: 150-394
Classification Level Classification E-value
Superfamily vWA-like 1.36e-79
Family Integrin A (or I) domain 0.000000262
Further Details:      
 
Domain Number 2 Region: 376-482
Classification Level Classification E-value
Superfamily Integrin domains 1.1e-20
Family Integrin domains 0.0036
Further Details:      
 
Domain Number 3 Region: 645-717
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.000000000000314
Family Integrin beta tail domain 0.0052
Further Details:      
 
Domain Number 4 Region: 562-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000558
Family Integrin beta EGF-like domains 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001367   Gene: ENSSHAG00000001218   Transcript: ENSSHAT00000001383
Sequence length 808
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861780.1:8440:26721:-1 gene:ENSSHAG00000001218 transcript:ENSSHAT00000001383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVFLGLLLAPGSGRREPDTGARSADGSPERGGADPPPGTPGRCQPAPSCRECLLSHHTCA
WCKLLLPGVPGGRRGSRGAVRGVALRAGPDRLLPAHRTSPPRGRRRRLSPPPSSSPLPPP
SPSSFSLLPPPPPSSSTGETQRLQVRFRRVEGYPVDLYYLMDLSYSMKDDLERVRQLGHA
LLVQLRGVTRSVRIGFGSFVDKTVLPFVNTIPSKLQHPCPSRLEKCQPPFSFRHVLPLTD
NASAFEYKVEQQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDIFHTAGD
GKLGGIFMPSDGHCHLDANGFYSRSRDFDYPSVGQVAHVLSAANIQPIFAVTSPALPVYK
ELSKLIPKSAVGELSEDSSNVVQLIMDAYNRLSSTVTLEHSPPPPGIHISYESQCGSSEI
REGKDDQGQCSQVQINQTVSFWVNIHATSCLPTPHLLKLRVLGFSEEVSVELHTLCDCNC
SDVQLQAPHCSHGQGDLQCGVCSCAPGRVGRLCECSEAELSSPDLEAGCRAPNGTGPLCS
GKGQCWCGRCSCNGQSSGDLCECDNASCERHEGILCAGFGQCRCGVCHCDANHTGQACEC
SKETSRCESPRGLCSGHGSCRCNQCQCLEGYYGATCDQCPGCKTACERHRDCAECGAFKT
GPLASNCSLACAHANVTVGPMSVPDDGWCKERSVDNQLLFFVVESEAEGKVVLRVKSRER
GADHTQAIVLGCTGGIVAVGLLLVLAYRLTVEIYDRREYNRFEKERKQLNWNQKDNPLYR
SAVTTTINPRFQNENLHKPSLTPQRPGH
Download sequence
Identical sequences G3VDW3
ENSSHAP00000001367 ENSSHAP00000001367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]