SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001465 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001465
Domain Number 1 Region: 30-238
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.16e-58
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 221-382
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-34
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 3 Region: 382-416
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000213
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001465   Gene: ENSSHAG00000001306   Transcript: ENSSHAT00000001481
Sequence length 424
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861790.1:9627:39561:-1 gene:ENSSHAG00000001306 transcript:ENSSHAT00000001481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKEEEEEEEEEEEEEEERYRMLSQEVIEETNEQKLHKIATELLLTERAYVNRLDLLDKIF
YCKLLEEANRGSFPTEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKL
APFLKMYGEYVKGFDNAMELVKTMTDRIAQFKSVIEEIQKQKICGSLTLQHHMLEPVQRI
PRYELLLKDYLKKLPPDSLDWNDAKKSLEIISTAASHSNSAIRKMDKLKKLLEVYEMLGE
EEDIVNPSNELIREGQILKLAARNTSAQERHLFLFNNMLLYCVPKFSLVGSKFSVRTRVG
IDGMKVVETHNEEYPHTFQISGKERTLELQASSEQDKEEWIKALQNTIEAFHQRHETFRN
AIAKDNDMHLEVSTAELGKRAPRWIRDNEVTMCMKCKESFNALTRRRHHCRACGHVSTSL
LPDD
Download sequence
Identical sequences G3VE61
ENSSHAP00000001465 ENSSHAP00000001465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]