SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001526 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001526
Domain Number 1 Region: 290-420
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.44e-43
Family Regulator of G-protein signaling, RGS 0.00000186
Further Details:      
 
Domain Number 2 Region: 13-116
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.57e-29
Family DEP domain 0.0051
Further Details:      
 
Domain Number 3 Region: 215-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 4.84e-18
Family Transducin (heterotrimeric G protein), gamma chain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001526   Gene: ENSSHAG00000001361   Transcript: ENSSHAT00000001542
Sequence length 475
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841552.1:10259:29669:-1 gene:ENSSHAG00000001361 transcript:ENSSHAT00000001542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTINTLHQAGSYKVQMPCLSKMERVIVGMQDPDMGVKMRNQRLLITVIPHAMTGSDIVEW
LIQKFSISEEESLHLGNLIVKHGYIYPLKDPRCLVLRADDSPYRFQTPYFWMSTKWPAAE
LDYAIYLAKKNIQKQGDLIDHEKDYYNQLHKKINHTWDFVVMQAREQLRAAKQRRKGDRI
VIECQEQTYWLVNRPPPGALNVMEQGPERGNCYTTRVQMTKNMDFYKREIEYCKKAMGRT
RVKSSICLEAYLKFNEQYMPHDPIMSGCLPSNPWITDDTDYWSMNAPTVAIPTKLRVERW
AFNFRELMGDPLGHIQFMEFLKKEFSAENLSFWEACEDLRYGEQSKIAESVDAVYQQFLA
PGATRWVNIDSKTMEKTLEGIRRPHRYVMDDAQMHIYMLMKKDSYPRFLKSDIYKTLLAE
AVIPPETKKRVFPFMRKQRHSSPSPALLLPSEQEPKGEDKGKNLTSGPSPGEEQS
Download sequence
Identical sequences G3VEC2
ENSSHAP00000001526 ENSSHAP00000001526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]