SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001683 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001683
Domain Number 1 Region: 99-153
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000000361
Family Tudor domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001683   Gene: ENSSHAG00000001499   Transcript: ENSSHAT00000001700
Sequence length 295
Comment pep:novel scaffold:DEVIL7.0:GL842194.1:22001:39962:1 gene:ENSSHAG00000001499 transcript:ENSSHAT00000001700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEPWSLPLESLAMAALGGGVREHEEPVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKN
ALKNGEISETSDKQKSAGPKRKNIKNRNKKKTNPAPLKQWKVGDACCAVWSEDGNIYPAT
IASADLKRGTCVVVYTGYGNKEEQNLSDLLLPNSEGVHDEETLHENENESQSQYSTDESE
KSSRSPGSKQNRIKSKAAHWNSYFPPPPPLPLPVPGLGKPGLKFSGPPPFLTGWPPPFPS
GPPLIPPPPPMSPDSPEDADALGSMLIAWYMSGYHTGYYLGLKQHQKEGRHQHFN
Download sequence
Identical sequences G3VES9
ENSSHAP00000001683 ENSSHAP00000001683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]