SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001746 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001746
Domain Number 1 Region: 71-583
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.06e-167
Family Myeloperoxidase-like 0.000000000000645
Further Details:      
 
Domain Number 2 Region: 30-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000285
Family EGF-type module 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001746   Gene: ENSSHAG00000001557   Transcript: ENSSHAT00000001764
Sequence length 601
Comment pep:known_by_projection scaffold:DEVIL7.0:GL835302.1:13130:30487:-1 gene:ENSSHAG00000001557 transcript:ENSSHAT00000001764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSRGRIWVLLSLLGLITGEYMNSVNSFPTVNPCCYFPCQHKGVCVRFGLNRYQCDCTQTG
YYGSNCTVPELWTRIREALRPSPSFYHFILTHGRCIWNIINSTFLRDVLMRLVLTVRANL
IPSPPTYNSEHGYISWESYANLSFYTRVLAPVPEDCPTPMGFKVILSAESQEILMKLIIS
LPSFLPFLPSFPSFLPSFLPSFLPSFLPSFLKSKMQVGINIGIGNSIHVDLGHIYGDNLE
RQYQLRLFKDGKLKFQMVDGEMYPPSVAETQVSMKYPANVPEAQQMAVGQEVFGLLPGLM
MYATIWLREHNRVCDILRDEHPTWNDEQLFQTTRLILIGETIKIVIEDYVQHLSGYFLKL
KFDPELLFGIQFQYQNHISVEFNHLYHWHPLMPDSFVVGQEEYSYEQFVFNTSMLLDYGV
EALVDAFSRQRAGQIGGVGNINHHVLHVAVSTIKESRELRLQSFNEYRKRFGLKPYTSFQ
ELTGEKQKSAELEELYGDIDALEFYPGLLLEKSLPDSIFGESMVEIGAPFSLKGLLGNPI
CSPEYWKPSTFGGETGFNIVKTATLQKLICLNVKTCPYVSFRVPDPHQEDNQKVKRPSAE
L
Download sequence
Identical sequences G3VEZ2
ENSSHAP00000001746 ENSSHAP00000001746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]