SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001760 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001760
Domain Number 1 Region: 113-246
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000105
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 2 Region: 215-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000408
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 43-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000711
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001760   Gene: ENSSHAG00000001569   Transcript: ENSSHAT00000001778
Sequence length 447
Comment pep:known_by_projection scaffold:DEVIL7.0:GL865139.1:13284:21444:1 gene:ENSSHAG00000001569 transcript:ENSSHAT00000001778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLVSFLRGQLLLLLLLGTASPQDPEEPDSYMECTDGYEWDAESQHCKDVNECETIPDA
CKGEMKCINHYGGYLCLPRSAAVINDVHSEGGPPPRPRPPRPPAPGPPRPNPCPQGYEPD
DQDNCVDIDECDLDLHDCRPSQECHNLPGSFHCSCPDGYRKMGSECVDIDECRYRYCQHR
CVNVPGSFTCQCEPGFQLGPNNRSCVDVNECEMGAPCEQRCFNSYGTFLCRCNQGYELHR
DGFSCNDIDECRHSTYLCQYHCSNEPGRFSCHCPQGYQLLGTRLCQDIDECETGTHQCSE
GQSCVNFHGGYRCVETNRCSEPYVQVSDNRCLCPASDPRCREQPSSIVHRYMSITSERSV
PADVFQIQATSVYPGAYNAFQIRAGNPQGDFYIRQINNISAMLVLARPVTGPREYVLDLE
MVTMNSLMSYRASSVLRLTVFVGAYAF
Download sequence
Identical sequences G3VF06
XP_003774426.1.9362 ENSSHAP00000001760 ENSSHAP00000001760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]