SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001979 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001979
Domain Number 1 Region: 446-700
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-50
Family YWTD domain 0.00000602
Further Details:      
 
Domain Number 2 Region: 8-268
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-30
Family YWTD domain 0.0000255
Further Details:      
 
Domain Number 3 Region: 275-403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000926
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 929-975
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000158
Family EGF-type module 0.00094
Further Details:      
 
Domain Number 5 Region: 825-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000645
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 787-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 869-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000155
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 405-460
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000583
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 707-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000572
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001979   Gene: ENSSHAG00000001762   Transcript: ENSSHAT00000002000
Sequence length 1013
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864779.1:17223:159505:1 gene:ENSSHAG00000001762 transcript:ENSSHAT00000002000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGTGPEPFLIFSHGNAIFRTDMEGTNHKQVVANAGKTVLMDFDYRKEKVYWVDLERGLL
QKVFLNGTKKETLCRTEKGISGMAIDWIHDEIVWSNQLKGTIETTDMKGNNSHVLLKELN
YPKNVVLDPIKRFIFWVANNITSTINRANINGTDVKILMQISQTIKTISLDILEQRLFWI
QDSSEESDLHVASCNYDGGSVHLLSYFTQYHYFGMSLFVENMYYSEWNTSAIWSVNKHTG
QKMVKISLKPSFLPPTEIKVVHQLLQPTVRNDTQNSEQEVCTLKKGYCKSSICGQNLKSH
PCKCAEGYTLSQDGKYCKDVNECVFWNHGCTLGCKNIPGSYYCTCPKGFILLSDGKRCQE
LISCVNNNTGCSHGCVMTSDGPMCFCPEGSVLGEDGKTCSGCSSIDNGGCSQICIPLSPV
SWECGCFPGYELQLNQKSCKAKGPQPFLLFANMRDIRRINFDGTKYESLLSRQMGEVLAL
DHDPVENKIYFAHTTLKWIERANMDGSEREILIQEGVDTPESLAVDWIDRKFYWTDRGKS
HIARSDLNGKYNEVIIEEDVSQPRGVAVHPMAKKLFWTDLGINPQIESSSLQGNDRLIIA
NTDLVWPSGITIDYVDNKLYWCDAKKSVIEVANLDGSGRRRLIQNDVDHPFDVAVFEDHV
WFSNWAKPSVIRVDKRTGQNRVCLRGSMLRPSSLVVIHPLAKPVAQENEACKHICKERFG
IVQCLCQEGFQKTQNKRICLLLVISSSQMNANNDTALLENVLGKTVEEKTREEQEPKHGL
VAEIMISDEDSCASVNCGVNAQCISKGKDAWCECLEGFIKNATLCSDIDECAMDNVLCQP
ESSECINTEGDYVCKCLEGYSGDGLNCYDIDECEMGTHTCGENALCKNTVGGYTCICSNG
APGFGSVCPGNTQKYHKPGDDVFSLIRNRQSECPPSYDSYCLHGGVCIYVSELENYACKC
MVGYVGERCQHSDLEWWEMRHMAKAKQQNITIAVCIIVLVLLLLLALGVTYYF
Download sequence
Identical sequences G3VFM5
ENSSHAP00000001979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]