SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001980 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001980
Domain Number 1 Region: 486-741
Classification Level Classification E-value
Superfamily YWTD domain 6.67e-50
Family YWTD domain 0.00000602
Further Details:      
 
Domain Number 2 Region: 48-308
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-30
Family YWTD domain 0.0000255
Further Details:      
 
Domain Number 3 Region: 315-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000144
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 923-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000199
Family EGF-type module 0.00094
Further Details:      
 
Domain Number 5 Region: 823-878
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000325
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 785-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.02
Further Details:      
 
Domain Number 7 Region: 867-901
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000172
Family EGF-type module 0.017
Further Details:      
 
Domain Number 8 Region: 445-500
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000629
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001980   Gene: ENSSHAG00000001762   Transcript: ENSSHAT00000002001
Sequence length 1129
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864779.1:17223:159505:1 gene:ENSSHAG00000001762 transcript:ENSSHAT00000002001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMWLFFLPWPLVFAFSVASVSGPQLQNTKCPPLSAEGNWRMTGTGPEPFLIFSHGNAIFR
TDMEGTNHKQVVANAGKTVLMDFDYRKEKVYWVDLERGLLQKVFLNGTKKETLCRTEKGI
SGMAIDWIHDEIVWSNQLKGTIETTDMKGNNSHVLLKELNYPKNVVLDPIKRFIFWVANN
ITSTINRANINGTDVKILMQISQTIKTISLDILEQRLFWIQDSSEESDLHVASCNYDGGS
VHLLSYFTQYHYFGMSLFVENMYYSEWNTSAIWSVNKHTGQKMVKISLKPSFLPPTEIKV
VHQLLQPTVRNDTQNSEQEVCTLKKGYCKSSICGQNLKSHPCKCAEGYTLSQDGKYCKDV
NECVFWNHGCTLGCKNIPGSYYCTCPKGFILLSDGKRCQELISCVNNNTGCSHGCVMTSD
GPMCFCPEGSVLGEDGKTCSGCSSIDNGGCSQICIPLSPVSWECGCFPGYELQLNQKSCK
AKGPQPFLLFANMRDIRRINFDGTKYESLLSRQMGEVLALDHDPVENKIYFAHTTLKWIE
RANMDGSEREILIQEGVDTPESLAVDWIDRKFYWTDRGKSHIARSDLNGKYNEVIIEEDV
SQPRGVAVHPMAKKLFWTDLGINPQIESSSLQGNDRLIIANTDLVWPSGITIDYVDNKLY
WCDAKKSVIEVANLDGSGRRRLIQNDVDHPFDVAVFEDHVWFSNWAKPSVIRVDKRTGQN
RVCLRGSMLRPSSLVVIHPLAKPASQMNANNDTALLENVLGKTVEEKTREEQEPKHGLVA
EIMISDEDSCASVNCGVNAQCISKGKDAWCECLEGFIKNATLCSDIDECAMDNVLCQPES
SECINTEGDYVCKCLEGYSGDGLNCYDIDECEMGTHTCGENALCKNTVGGYTCICSNGAP
GFGSVCPESFQPGDDVFSLIRNRQSECPPSYDSYCLHGGVCIYVSELENYACKCMVGYVG
ERCQHSDLEWWEMRHMAKAKQQNITIAVCIIVLVLLLLLALGVTYYFRTQKLHKKNPTSE
MTGESVVASTFGEDMMLSNHKPWVLVVKEQPQCSTGSHQVNFTDCQTTNGDQPSPPESGY
MWMESWNREIQTIEEMGKNQNYQHQPSIDQLHPQGIEENPHHFLPSGPL
Download sequence
Identical sequences G3VFM6
ENSSHAP00000001980 ENSSHAP00000001980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]