SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000001988 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000001988
Domain Number 1 Region: 295-556
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.73e-79
Family Eukaryotic proteases 0.0000806
Further Details:      
 
Domain Number 2 Region: 3-52
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-16
Family Fibronectin type II module 0.003
Further Details:      
 
Domain Number 3 Region: 60-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000315
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000001988   Gene: ENSSHAG00000001769   Transcript: ENSSHAT00000002009
Sequence length 565
Comment pep:known_by_projection scaffold:DEVIL7.0:GL865456.1:17298:51536:-1 gene:ENSSHAG00000001769 transcript:ENSSHAT00000002009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PVFTEDGQLCSFPFRYGGRMHHSCTSNVRSLKKWCATTHNYDRDRKWGYCIMTSKENTSS
LDYCASSPCRNGGSCSNSQDATSYHCACPEEFTGKDCEMEKCFDETRYEYFDIDESWARI
HQGVVEWCNCSKGHIECEKIRYTGSPVSPILPGGSCCCERINSGKMTQMDHGNKHQIIYT
IRNQRCSIAGSVHYCSIGNDLANFLFLIAYIYIYIYIYIYISQEGVMDLIFKQSHSRSRH
LEPDGSPVPELFPLKDGVQGLSLFNILSSSAFSPVPVNNPRSGSRPNMEFLAIPETSLPN
RRACGKRHKKRTFLRPRIIGGSSSLPGSHPWMAAIYIGEVFCAGSLIHSCWVVSAAHCFA
NSPPKSIIRVVLGQHFFNTSTDVTQTFEVEKYILYPLYSVFSPSNHDLVLVRLKKKGDRC
AVKSQFVQPICLPENGITFPDNHKCQIAGWGHMYENVTGYATYLREALLPLLPDHKCSSP
EVYGADITPNMFCAGYFDCKSDACQGDSGGPLACEKNGVSYLYGIISWGDGCGRFNKPGV
YTRVTNYVDWINDKIRPPKKVTTAS
Download sequence
Identical sequences G3VFN4
ENSSHAP00000001988 ENSSHAP00000001988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]