SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002036 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002036
Domain Number 1 Region: 84-180
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 3.01e-24
Family PWWP domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002036   Gene: ENSSHAG00000001810   Transcript: ENSSHAT00000002058
Sequence length 191
Comment pep:known_by_projection scaffold:DEVIL7.0:GL834830.1:17885:18460:1 gene:ENSSHAG00000001810 transcript:ENSSHAT00000002058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFGEGGRDGLAFLMNYKRKADSSSLSVGSDSLDESSSDAASPGGCDFLPGDDASVSSSSR
EERKTVPPLTVRLHAQSVARCATEDGRTVAVGDIVWGKIPGCPWWPARVLDLSLGQKEDG
QPSWREARVAWFGSPTTSCLSLSKLSPFSEFFKLRFNRKKKGVYRKAITEAAKAAEHLSP
EVRELLSQFET
Download sequence
Identical sequences G3VFT2
ENSSHAP00000002036 ENSSHAP00000002036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]