SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002129 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002129
Domain Number 1 Region: 93-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Integrin beta EGF-like domains 0.014
Further Details:      
 
Domain Number 2 Region: 285-313
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number 3 Region: 192-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family Integrin beta EGF-like domains 0.024
Further Details:      
 
Domain Number 4 Region: 228-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002129   Gene: ENSSHAG00000001894   Transcript: ENSSHAT00000002153
Sequence length 347
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849851.1:19413:244576:-1 gene:ENSSHAG00000001894 transcript:ENSSHAT00000002153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHTTSLSKFLLLASSLFFTVSSAVPQGFSPSLRSGPGATCRLSRAEAERRCRAPGQPPGS
QLCNGRGRCDCGVCICHVTEPGMYLGPLCECHEWVCETYDGETCAGHGKCDCGKCKCDEG
WYGEACQYPTNCNLTKKKSNQMCKNSQDTICSNAGTCHCGRCKCDNSEGNGLVYGKFCEC
DDRECIDDETEEMCGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGKICS
NRGTCVCGECSCHDVDPTGDWGDIHGDTCECDERNCRSVYDRYSDDFCSGHGQCNCGRCD
CKVGWSGKKCEHPLSCPLSAEDSIKKCQGSSNLPCSGRVLKRVYEWW
Download sequence
Identical sequences G3VG25
ENSSHAP00000002129 ENSSHAP00000002129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]