SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002165 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002165
Domain Number 1 Region: 33-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-36
Family SCAN domain 0.0000767
Further Details:      
 
Domain Number 2 Region: 329-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.74e-26
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 3 Region: 580-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.42e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 524-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.07e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 622-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.37e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 8 Region: 126-183
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-18
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 9 Region: 375-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000125
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 293-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000586
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002165   Gene: ENSSHAG00000001927   Transcript: ENSSHAT00000002189
Sequence length 691
Comment pep:novel scaffold:DEVIL7.0:GL841582.1:20085:51422:1 gene:ENSSHAG00000001927 transcript:ENSSHAT00000002189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAEVRKAMCLGVQEKRDDPWGPGSSLQQDSQISYEVFRQRFRQLCYHETSGPQEALSQL
RDLCGRWLRPDMNTKMQILELLVLEQFITILPREIRMWVQLHHPESGEEAVAMVKDFQRH
LDGPGQKDLVTFEDVSVDFTQKEWKSSTPAQRAFFRDLMLENYRDVVSLGFPFSKPMGIS
QREEKPWGLNHQAPLALEDGKSTCTECDNVSENEESTSKQGNFGESESHKSSSEVLQKDL
SKASEAGEASEKEIILEQQQGTLPEEEIRTIDNEFMEVIVQNKKIPIEERDEKCKEFWES
FSLVSNTVTQEKIPRGQKSYQCNECGKYFNRSSHLIGHQRIHTGEKPYECNECGKSFRQT
SQLIVHLRIHTGEKPYECNECGKAYRHSSHLIHHQRLHNGEKPYKCNECVKAFTQSSQLI
DHQRIHTGEKPYECNMCGEAFSRSKSLIRHQILHTGEKPYKCNECGKAFCSNRNLIDHQR
THTGEKPYKCNECGKAFSRSKCLIRHQSLHTGEKPYKCSECGKTFSQGSQLIDHERIHTG
EKPFACSECGKAFSLSKSLIRHQRLHTGERPYKCNDCGKSFNQNSHLIIHQRIHTGEKPY
ECNECGKVFSYSSSLLVHKRTHTGEKPYECHDCGKAFSDSSQLIVHQRIHTGEKPYECKE
CGKAFSQRSTFNHHQRIHSGEKHSALVHSVF
Download sequence
Identical sequences G3VG61
ENSSHAP00000002165 ENSSHAP00000002165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]