SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002257 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002257
Domain Number 1 Region: 226-409
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-37
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 2 Region: 676-856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.42e-36
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 3 Region: 61-256
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.72e-35
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 4 Region: 864-1069
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.33e-33
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 5 Region: 1-68
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.55e-17
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0034
Further Details:      
 
Domain Number 6 Region: 468-535
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.00000000000164
Family Fibrinogen C-terminal domain-like 0.0017
Further Details:      
 
Domain Number 7 Region: 439-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000112
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002257   Gene: ENSSHAG00000002005   Transcript: ENSSHAT00000002281
Sequence length 1205
Comment pep:novel scaffold:DEVIL7.0:GL841481.1:21724:607133:-1 gene:ENSSHAG00000002005 transcript:ENSSHAT00000002281 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSDTGRNWKQYRQEESIWGFSGNTNADSVVYYKLQHSIKARFLRFIPLDWNPNGRIGMR
IEVYGCSYRSEVVDFDGKSFLLYRFDEKSTNPLKDVISFKFKTIESDGILLHRKGQNGDY
ITLELIKGKLFLFINSGDTKLHSTNSLINITTGSLLDDLHWHSVLIEYFNKQVNFTVDKH
TQHFHAKGEFNYLDLNYELSFGGTLASGKSVSFSHRNFHGCFENLYCNGINIINLAKRQK
PQIYIMGNVSFSCSQPQTVPVTFLGSGSYLALHGSSGQDEISVSFQFRTWNKMGLLLSSN
FHQYSGGLLLYLHDGKIKLNLFKLGKQQSDITAGVELNNGQWHSISLSAKRNHLSIMIDN
DVTSVLHFVLPMQIYSGDIYYFGGCPNTSSDYECKNPFGGFQGCMRQISISNKVVDLISV
QQSIFGNFSDLQIDLCGLIDRCLPNYCEHGGECSQSWNSFYCNCTNTGYMGATCHYSIYE
QSCEAYKHKGNTSGFYYIDSDGSGPLGPFLVYCNMTENKNTSWTIVQHNSSDFTRVKSSN
RENPHTVFFKYTANTEQLQATINHAEHCEQELAYHCKKSRLLNKRDGIPLSWWVGRTNET
QTYWGGSSPNIQKCTCGLQGNCIDSQYYCNCDADRNEWANDTGFLSYKEHLPVTQIVITD
TDRPNSEAAYKLGPLLCRGDNGTGSFWNSASFNTETSYLHFPTFHGELSADVSFFFKTTA
SSGVFLENLGIKDFIRIELHSPAEVTFSFDVGNGPFEVMVQSPTHLNDNQWHYVRAERNI
KEASLQVDQLPPKSQAAPVDGHILLQLNSQLFVGGTASRQKGFLGCIRSLQLNGIALDLE
ERAKITPGVDPGCPGHCSSYGNLCHNGGKCKEKHSGFSCDCSFSAYSGPFCLNEISAYFG
SGSSVTYNFQEYYTLSKNSSSHAASFHGDMTLIRETITFSFRTTRTPSLLLYVGSFYKEY
LSVILAKNGSLQIRYKLDSHQEPDVFNSNFKNMADGQLHHVKINREEGVLFVEVNQNPRE
QVTLSSGIEFNAIKSLVLGKILENNDVDQETMKANSQGFIGCLSSVQFNHIAPLKAALHH
TSSAPVTIKGHVAESNCGTLTGAESTLSETTHSFAATDHSGPIDEGEPLANAIRSDSAII
GGVIAVVIFILLCITAIAVRIYQQKSLYKKNETKRAENEDCTETALKSELTMQNRVNENQ
KEYFF
Download sequence
Identical sequences G3VGF3
ENSSHAP00000002257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]