SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002258 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002258
Domain Number 1 Region: 43-183
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.32e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 341-524
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.25e-37
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 3 Region: 728-744,779-942
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.83e-37
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 4 Region: 176-371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.85e-35
Family Laminin G-like module 0.0059
Further Details:      
 
Domain Number 5 Region: 973-1178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.19e-33
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 6 Region: 583-647
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000015
Family Fibrinogen C-terminal domain-like 0.0021
Further Details:      
 
Domain Number 7 Region: 554-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000124
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002258   Gene: ENSSHAG00000002005   Transcript: ENSSHAT00000002282
Sequence length 1312
Comment pep:novel scaffold:DEVIL7.0:GL841481.1:21724:607133:-1 gene:ENSSHAG00000002005 transcript:ENSSHAT00000002282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMNMDSVTEAFLKLLFLLPIQNWSPVVSGNIHNCDDPLVSTLPQSSFSCSSELSSSHSP
GFARLNRRDGAGGWSPLVSNKYQWLQIDLGDRMEITAIATQGGYGSSDWVTSYLLMFSDT
GRNWKQYRQEESIWGFSGNTNADSVVYYKLQHSIKARFLRFIPLDWNPNGRIGMRIEVYG
CSYRSEVVDFDGKSFLLYRFDEKSTNPLKDVISFKFKTIESDGILLHRKGQNGDYITLEL
IKGKLFLFINSGDTKLHSTNSLINITTGSLLDDLHWHSVLIEYFNKQVNFTVDKHTQHFH
AKGEFNYLDLNYELSFGGTLASGKSVSFSHRNFHGCFENLYCNGINIINLAKRQKPQIYI
MGNVSFSCSQPQTVPVTFLGSGSYLALHGSSGQDEISVSFQFRTWNKMGLLLSSNFHQYS
GGLLLYLHDGKIKLNLFKLGKQQSDITAGVELNNGQWHSISLSAKRNHLSIMIDNDVTSV
LHFVLPMQIYSGDIYYFGGCPNTSSDYECKNPFGGFQGCMRQISISNKVVDLISVQQSIF
GNFSDLQIDLCGLIDRCLPNYCEHGGECSQSWNSFYCNCTNTGYMGATCHYSIYEQSCEA
YKHKGNTSGFYYIDSDGSGPLGPFLVYCNMTDTSWTIVQHNSSDFTRVKSSNRENPHTVF
FKYTANTEQLQATINHAEHCEQELAYHCKKSRLLNKRDGIPLSWWVGRTNETQTYWGGSS
PNIQKCTCGLQGNCIDSQYYCNCDADRNEWANDTGFLSYKEHLPVTQIVITDTDRPNSEA
AYKLGPLLCRGDRSFWNSASFNTETSYLHFPTFHGELSADVSFFFKTTASSGVFLENLGI
KDFIRIELHSPAEVTFSFDVGNGPFEVMVQSPTHLNDNQWHYVRAERNIKEASLQVDQLP
PKSQAAPVDGHILLQLNSQLFVGGTASRQKGFLGCIRSLQLNGIALDLEERAKITPGVDP
GCPGHCSSYGNLCHNGGKCKEKHSGFSCDCSFSAYSGPFCLNEISAYFGSGSSVTYNFQE
YYTLSKNSSSHAASFHGDMTLIRETITFSFRTTRTPSLLLYVGSFYKEYLSVILAKNGSL
QIRYKLDSHQEPDVFNSNFKNMADGQLHHVKINREEGVLFVEVNQNPREQVTLSSGIEFN
AIKSLVLGKILENNDVDQETMKANSQGFIGCLSSVQFNHIAPLKAALHHTSSAPVTIKGH
VAESNCGTLTGAESTLSETTHSFADHSGPIDEGEPLANAIRSDSAIIGGVIAVVIFILLC
ITAIAVRIYQQKSLYKKNETKRAENEDCTETALKSELTMQNRVNENQKEYFF
Download sequence
Identical sequences G3VGF4
ENSSHAP00000002258 ENSSHAP00000002258 XP_012398109.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]