SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002435 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002435
Domain Number 1 Region: 687-833
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-40
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1013-1113
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-31
Family Ras-binding domain, RBD 0.00085
Further Details:      
 
Domain Number 3 Region: 218-374
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-22
Family Phosphotyrosine-binding domain (PTB) 0.013
Further Details:      
 
Domain Number 4 Region: 8-102
Classification Level Classification E-value
Superfamily PDZ domain-like 3.86e-20
Family PDZ domain 0.0094
Further Details:      
 
Domain Number 5 Region: 958-1027
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000015
Family Ras-binding domain, RBD 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002435   Gene: ENSSHAG00000002156   Transcript: ENSSHAT00000002461
Sequence length 1373
Comment pep:known_by_projection scaffold:DEVIL7.0:GL864873.1:80188:230177:-1 gene:ENSSHAG00000002156 transcript:ENSSHAT00000002461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYKPAETVKRRLNVHAPPRIRSVDVARGRAGYGFTLSGQAPCVLSCVMKGSPADYVGLKA
GDQIFAVNDINVKKASHEDVVKLIGKCSGVLHMIICEGISHMDSCSSDEEVGFYEGKGWL
KPKLDSKALGINRAERVVEEMQSGGIFSMIFENPTLCAASSDHSKLKQRSLSESAAAASR
FDIAQESLTSPNYNLHSKDEMSKVIHDDSVFSIGLENHDDFGLDASILNVAMVVGYLGSI
ELPSTSSNLEYDSLQAIRGCMRRLRAEQKIHSLVMMKIMHDCIQLCTDKAGVVAEYPAEK
LAFSAVCPDDRRFFGLVTMQTNDDGSLAQEDEGVLRTSCHVFMVDPELFSHKIHQGIARR
FGFDCTADPDTNGCLEFPTSSLPVLQFISVLYRDMGELIEGMRARAFLDGDADAHQNNST
SSNSDSGIGNFNQEEKSNRVLVVDLGGSSSKHIPSNLWENPGGRAPNLPAAHWNGFCHDS
EGSSLEPTQNDKFCELNKHLGPSSRMEIPLVSSRSSVPPSKRSATGMGGGANQRWLPVHV
LQEWQHGHASDQESYTDSTDGWSSVNCGTLPPPMNKIPADRYRVEGSFVQPQLSAHKSEW
SKKAFGMQNFFGPHRNVRKMKEDKKSSKFGIGLLPTPQRTSTRRSFGRSKRFSITRSLDD
LESATVSDGELNSTDLKDCVSNNSLSSNASLPSVQSCRRLRERRVASWAVSFERLLQDPI
GVRYFSDFLRKEFSEENILFWQACEYFSHVPAHDKKELSYRAREIFTKFLCSKATTPVNI
DSQAQLADDILNAPHPDMFKEQQLQIFNLMKFDSYTRFLKSQLYQECILAEVEGRSLPDS
QQVPSSPASKHSISSDRSNVSTPKKLSGKSKSGRSLNEESGEEDGEKKRKGTFFSWSRNK
STGRSQKKKEHGDHPHDTLHSNGGLHRRESQGSMSSGASLDLSDTFRVSVAEKDKSSKHC
CINLPDGTSCVVVVKSGFSIKEILSGLCEKHGINVAAVDLFLVGGDKPLVLHQDSSILDS
RDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLNLSDLVVRLSGEKEP
LDLGVPISNLDGQRVILEEKDPTKGKVFTDKQKGASAKQNIAVIPSSRNHSATGEERTLG
KSNSIKIKGENGKNARDPRLSKREESIAKIGKKKYQKINLDEAEEFFELISKAQSNRADD
QRGLLRKEDLVLPEFLRLPPCAAEPTASTPAAAKGLSKRTVKNGSKEKAAQPNGKLESPP
SGPESPAKSPGPAESKPRPPLAALPTQKSYSGPFSAPLSPIPRVQEAQIWKRQSEELPGE
GIQTIDDDNVADLTLVGEGDISSPNSTLLPPPPTPHKQEKPGYQRSVSGISRF
Download sequence
Identical sequences G3VGY1
ENSSHAP00000002435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]