SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002511 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002511
Domain Number 1 Region: 236-379
Classification Level Classification E-value
Superfamily PH domain-like 2.87e-47
Family Phosphotyrosine-binding domain (PTB) 0.00000198
Further Details:      
 
Domain Number 2 Region: 407-513
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-18
Family PDZ domain 0.00014
Further Details:      
 
Domain Number 3 Region: 507-590
Classification Level Classification E-value
Superfamily PDZ domain-like 1.97e-16
Family PDZ domain 0.0000917
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002511   Gene: ENSSHAG00000002223   Transcript: ENSSHAT00000002539
Sequence length 598
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841410.1:26352:32251:-1 gene:ENSSHAG00000002223 transcript:ENSSHAT00000002539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSGVSSSGPPAMDLEQSEASNPLPFGPPPPAATPSEPHCPWDLAVPEAAPTSDLEGTGP
EAVGSQNQMDLDEDPSGQELQDLVGQFQALPLDLPEAPSQNGHPCPLHIATGHGLTTPEA
SENHGLLSSEARHEDLINLLCGEEGAPLTQTAPPSPEGPQGPVPCLLQPPKDCAERTEEG
SVDGEGSSSSSPEPWLGPGPLVHSEDLSADVGATQNSEALASYPTFQEVAGPCDPEDLLD
GVIFGAKYLGSTQLVSERNPSLSARMAQAQEAVDRIKAPEGETQPMTEVDLFISTKRIKV
LTADSQEAMMDHSLQTISYIADIGNVVVLMARRRLARQPGSQERRLYKMICHVFHSADAQ
LIAQAIGQAFGVAYGQFLRASGIDPSQLSTQDHGRPKEGDLHNGDLAHFSNQENCRDVCI
EKQRGECLGVALVESGWGSLLPTAVIANLLHGGPAERSGLLSIGDRLTAVNGTSLVGLPL
ASCQAIVRELKSETSVTLSIVHCPPVTTAIIRRPHAREQLGFCVENGIICSLMRGGIAER
GGVRVGHRIIEINGQSVVATPHDRIIQLLTQAHDEVHIKMMPASTYRLLTGQEQPVYL
Download sequence
Identical sequences G3VH57
ENSSHAP00000002511 XP_003760630.1.9362 ENSSHAP00000002511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]