SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002516 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002516
Domain Number 1 Region: 600-783
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.42e-48
Family Nucleotide and nucleoside kinases 0.0000000486
Further Details:      
 
Domain Number 2 Region: 3-157
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-37
Family Protein kinases, catalytic subunit 0.0000934
Further Details:      
 
Domain Number 3 Region: 466-584
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-33
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 4 Region: 333-433
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-21
Family PDZ domain 0.0000162
Further Details:      
 
Domain Number 5 Region: 201-252
Classification Level Classification E-value
Superfamily L27 domain 7.65e-20
Family L27 domain 0.0000947
Further Details:      
 
Domain Number 6 Region: 262-313
Classification Level Classification E-value
Superfamily L27 domain 0.0000000000000371
Family L27 domain 0.0000547
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002516   Gene: ENSSHAG00000002228   Transcript: ENSSHAT00000002544
Sequence length 787
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849544.1:26420:189611:1 gene:ENSSHAG00000002228 transcript:ENSSHAT00000002544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLHKDYNPHCVLLASKENSAPVKLGGFGVAIQLGESGLVAGGRVGTPHFMAPEVVKREP
YGKPVDVWGCGVILFILLSGCLPFYGTKERLFEGIIKGKYKMNPRQWSHISESAKDLVRR
MLMLDPAERITVYEALNHPWLKERDRYAYKIHLPETVEQLRKFNARRKLKGAVLAAVSSH
KFNSFYGDPPEELPDFSEDPTSSGAVSQVLDSLEEIHALTDCSEKDLDFLHSVFQDQHLH
TLLDLYDKINTKSSPHIRNPPSDAVQRAKEVLEEISCYPENNDAKELKRILTQPHFMALL
QTHDVVAHEVYSDEALRVTPPPTSPYLNGDSPESANGDMDMENVTRVRLVQFQKNTDEPM
GITLKMNELNHCIVARIMHGGMIHRQGTLHVGDEIREINGISVANQTVEQLQKMLREMRG
SITFKIVPSYRTQSSSCERDSPSTSRQSPANGHSSTNNSVSDLPSTTQPKGRQIYVRAQF
EYDPAKDDLIPCKEAGIRFRVGDIIQIISKDDHNWWQGKLENSKNGTAGLIPSPELQEWR
VACIAMEKTKQEQQASCTWFGKKKKQYKDKYLAKHNAVFDQLDLVTYEEVVKLPAFKRKT
LVLLEIGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQD
ISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAA
PTITPGINEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAIELVCTAPQW
VPVSWVY
Download sequence
Identical sequences G3VH62
ENSSHAP00000002516 ENSSHAP00000002516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]