SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002523 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002523
Domain Number 1 Region: 118-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000404
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002523   Gene: ENSSHAG00000002234   Transcript: ENSSHAT00000002551
Sequence length 185
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861730.1:26545:51502:1 gene:ENSSHAG00000002234 transcript:ENSSHAT00000002551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEYFYEFLSLRSLDKGIMDDPTINIPLLGSVPHKASVVQVGFPCLGKQDGVAAFEVNVII
MNSEGNIILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRVCKCTDGFYGPHCEKALCMP
RCMNGGLCVTPGLCICPPGFYGVNCEKANCSTTCFNGGTCFYLGKCICPPGLEGDQCEKI
TSYCS
Download sequence
Identical sequences G3VH69
ENSSHAP00000002523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]