SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002668 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002668
Domain Number 1 Region: 18-130
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000206
Family Regulator of G-protein signaling, RGS 0.0063
Further Details:      
 
Domain Number 2 Region: 252-365
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000037
Family Regulator of G-protein signaling, RGS 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002668   Gene: ENSSHAG00000002358   Transcript: ENSSHAT00000002697
Sequence length 399
Comment pep:novel scaffold:DEVIL7.0:GL856757.1:29746:56471:1 gene:ENSSHAG00000002358 transcript:ENSSHAT00000002697 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAETERETETKRGREGQRQRQNLMDVLHHPVHLEYFKEFLRANKAENLLSFILAMQKASS
EPNEKAQKALVDAILNTFFHNKDSDVEDILQCTIPILKEISYMNRVPLVVLHQAQNQVLK
YLDDKWFKTYQDMFPHRLHIQIPDVEIPQKVPKKETKTINLELRKKRVWIYLSAIIRSIC
KFRREMKKPESRRLFEDFLRKEMTNHKETGPPKTVTTISTPPLQKTALDVDMEDIVFVKR
RILGHKTVIINFLVNDLNFFIEIEKFNDLVSSALVLQVNKVFNENDVALMKAKGHIIYKL
FLSSDIPPRLRVNISEITKDSIYSAITDGHLDRAVFHNSVMTIFPIIMYFWKKYCNWKAK
RDYLRSWGKKSKEHSPARSVSPKQNQWSGGKLWAMISCS
Download sequence
Identical sequences G3VHL4
ENSSHAP00000002668 ENSSHAP00000002668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]