SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000002697 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000002697
Domain Number 1 Region: 25-134
Classification Level Classification E-value
Superfamily PDZ domain-like 4.21e-20
Family PDZ domain 0.0000765
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000002697   Gene: ENSSHAG00000002387   Transcript: ENSSHAT00000002728
Sequence length 281
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841496.1:30503:44846:-1 gene:ENSSHAG00000002387 transcript:ENSSHAT00000002728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPPPGDVDLRRRALEEDNIASAGVFPPLINPSQHTLSTTIKTSLKMRAQGLGLIIFQHG
PYLQIANLVEKGTAAKDGRLKPGDVLISIGHSNVLGYTLREFLQLLHHIPIGAILQIRVY
RDFIDIPPEWQNIDDLIPETKPAIVIANTSRKYEEKDTSFSSSEDDEDVDLDKRFKYYRS
PQSFRRHPIKKLSSISTEWHGYKKKNHMFTVGEDIGCDVMIHKDLDEKKADVPKDFRAPS
PYWTMVKQDSDISSSSSSTSDAFWLEDCAYAQQEKDQHFTA
Download sequence
Identical sequences G3VHP3
ENSSHAP00000002697 ENSSHAP00000002697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]