SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Sarcophilus harrisii 76_7.0 > ENSSHAP00000003206

Domain assignment for ENSSHAP00000003206 from Sarcophilus harrisii 76_7.0

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSSHAP00000003206
Domain Number 1	Region: 141-245
Classification Level	Classification	E-value
Superfamily	Bromodomain	7.46e-22
Family	Bromodomain	0.0013
Further Details:

Domain Number 2	Region: 1-60
Classification Level	Classification	E-value
Superfamily	SAND domain-like	1.92e-20
Family	SAND domain	0.00057
Further Details:

Domain Number 3	Region: 63-123
Classification Level	Classification	E-value
Superfamily	FYVE/PHD zinc finger	0.000000000494
Family	PHD domain	0.0097
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSSHAP00000003206 Gene: ENSSHAG00000002829 Transcript: ENSSHAT00000003242
Sequence length	256
Comment	pep:novel scaffold:DEVIL7.0:GL857037.1:42744:66875:1 gene:ENSSHAG00000002829 transcript:ENSSHAT00000003242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	TLYKEKLEKGSSEKCIEMADGTWLTPRELEVKGGRERSKNWKKSIYCGGLTLSNLIQESL EFPSHSLGECPENSNECFVCTDGGKLFCCDSCPRSFHRDNSSLRPLSAQWFCTFCIIRMN KEKRSSYNKSCQLESEALKHQMCFEQQVKCEYLLMKMYCCRESMLFATDPRNFTAYSKCV REPMWLDLIKKRLSDETYNTVEGFVLDMRLIFNNCKKFNKDNQFGHLGAKMKEKFEKDFK EVFNIMSRSNSVCCFL
Download sequence
Identical sequences	G3VJ51 ENSSHAP00000003206 ENSSHAP00000003206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]