SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003587 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003587
Domain Number 1 Region: 100-311
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-53
Family DBL homology domain (DH-domain) 0.0000923
Further Details:      
 
Domain Number 2 Region: 306-451
Classification Level Classification E-value
Superfamily PH domain-like 1.62e-18
Family Pleckstrin-homology domain (PH domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003587   Gene: ENSSHAG00000003150   Transcript: ENSSHAT00000003624
Sequence length 540
Comment pep:known_by_projection scaffold:DEVIL7.0:GL861620.1:53445:71548:1 gene:ENSSHAG00000003150 transcript:ENSSHAT00000003624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDEIGSFLPIKRTIRVLDINNTSLQEEPSNKRVRSLARVSSLANLISPVRNGAVKRF
GQTIQSFTLRGDNRSPASAQKPFNRATVPTPSKRRNSVRWSEMLDINMKESLTTKEIKRQ
EAIYEMLRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLARL
GEATKPDGTVEQIGHILVNWLPGLNAYRGYCSNQLAAKALLDQKKQDARVQDFLQRCLES
PFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHTDIKLLEESLLVMQGVLSDINLK
KGESECQYYIDKLEYLDDKQKDPRIDASKVLLCHGELKNKNGHKLYVFLFQDILVLTRPV
IRNERHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFRDPLPG
QSHTLQANDVFHKQQWFNCIRTAIAPFHQTTSPTEFKGLSELNKGCEKNNTLASHIKAQR
KSSTLSGLIPLEVDENSPEYASSVAINEDSTGIKPYRIQSGSQKAQEKAQLNDKRKETLV
Download sequence
Identical sequences G3VK82
XP_012406291.1.9362 ENSSHAP00000003587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]