SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000003905 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000003905
Domain Number 1 Region: 902-1081
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-52
Family DBL homology domain (DH-domain) 0.0000000132
Further Details:      
 
Domain Number 2 Region: 468-618
Classification Level Classification E-value
Superfamily Spectrin repeat 3.05e-18
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 139-280
Classification Level Classification E-value
Superfamily Spectrin repeat 7.2e-18
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 4 Region: 715-854
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-16
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 5 Region: 1088-1148
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000676
Family Pleckstrin-homology domain (PH domain) 0.0000881
Further Details:      
 
Domain Number 6 Region: 7-113
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000127
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 7 Region: 285-392
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000209
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000003905   Gene: ENSSHAG00000003439   Transcript: ENSSHAT00000003944
Sequence length 1150
Comment pep:novel scaffold:DEVIL7.0:GL849584.1:63457:301073:1 gene:ENSSHAG00000003439 transcript:ENSSHAT00000003944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFH
QKAEQFLSGVDAWCKMCSEGGLPSETQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLDV
LQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVF
QQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAA
EQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQ
KELLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRDSAVSSNKTPHN
SSISHIESVLQQLDEAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLR
QMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKD
IDLAAQVQELLEFLHEKQHELELNADQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLN
ASLVNASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEVLLQAGHYDADAIRECAEK
VAMHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAA
EIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTRGPEQQVKA
ILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYFLSTHNSTGDS
TEETQELLKEYGEFRVPAKEQQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKHYR
DFSLRMGKYRYSLEKALGVNTEKNKDNKDLELDIIPASLSDREVKLRDANHEVNEEKRKS
ARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQEIYD
FHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSSQLILEHAGTFFDEIQ
QRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMH
VSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHT
KYVYKNKLLV
Download sequence
Identical sequences G3VL50
ENSSHAP00000003905 ENSSHAP00000003905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]