SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004028 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004028
Domain Number 1 Region: 1099-1207
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-34
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 417-531
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-34
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1623-1732
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-32
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 4 Region: 1446-1565
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-32
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 5 Region: 243-362
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-31
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 6 Region: 76-187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-29
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 7 Region: 1795-1902
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-28
Family Spermadhesin, CUB domain 0.00055
Further Details:      
 
Domain Number 8 Region: 1975-2079
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.23e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 9 Region: 589-710
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-26
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 10 Region: 1267-1383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-23
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 11 Region: 2571-2639
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.95e-19
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 12 Region: 2331-2399
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.03e-19
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 13 Region: 2747-2816
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.99e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 14 Region: 2388-2455
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.48e-17
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 15 Region: 2687-2752
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.48e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 16 Region: 2867-2935
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.2e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 17 Region: 13-85
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000175
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 18 Region: 2629-2698
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000181
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 19 Region: 2447-2514
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000256
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 20 Region: 2273-2335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 21 Region: 1737-1805
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000526
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2503-2564
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000106
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 1564-1626
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 24 Region: 1212-1279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000405
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 25 Region: 537-597
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000653
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 26 Region: 2081-2154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000675
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 27 Region: 2799-2861
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 28 Region: 191-253
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000445
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 29 Region: 2144-2213
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000917
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 30 Region: 768-822
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000113
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 31 Region: 1390-1454
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 32 Region: 1907-1970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000351
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 33 Region: 362-430
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000542
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 34 Region: 2217-2283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000723
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 35 Region: 2926-2984
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000131
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 710-772
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000297
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004028   Gene: ENSSHAG00000003551   Transcript: ENSSHAT00000004068
Sequence length 3220
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849782.1:66880:472949:-1 gene:ENSSHAG00000003551 transcript:ENSSHAT00000004068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVTQVGVSQGHNMCPDPGIPERGKRLGSDFRLGSSIQFTCNEGYDLQGSKRITCMKVSDM
FAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHCVWVITAINPAKVIKLTFE
EFDLERGYDTLTVGDGGQDGDQKTVLYVLTGNTVPDLIVSTNHQMWLLFQTDSSSSSLGF
KASYEEIDQGSCGDPGVPAYGRREGSRFRHGDTLKFECQPAFELVGQKAITCQKNNQWSA
KKPGCVFSCFFNFTSPSGIVLSPNYPEEYGNHLHCVWLILAKPESRIHLAFNDIDVEPQF
DFLAIKDGATAESPVLGTFSGSQIPSSLTSSGHVARLEFQTDHSTGKRGFNITFTTFRHN
ECPDPGVPVNGKRFGDSLQLGSSISFLCDEGFLGTHGSETVTCILKEGSVVWNNAVLRCE
APCGGHLTSPSGTILSPGWPGFYKDALNCVWVIEAQPGYPIKITFDRFKTEVNYDTLEVR
DGRTYSSPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDIGFQIRYETVTIQSDHCLD
PGIPVNGHRHGNDFYVGALVTFSCDSGYTLSDAEALECEPNFQWSRALPSCEALCGGFIQ
GSSGTILSPGFPDFYPNNLNCTWVIETSHGKGVYFTFHTFHLESGHDYLLITENGSFTQP
LKQLTGSRLPAPISAGLYGNFTAQIRFVSDFSMSYEGFNITFSEYDLEPCEEPEVPAYSI
RKGLQFGVGDVLTFSCFPGYRLEGVARITCLGGRRRVWSSALPRCVAECGSSVTGTQGIL
LSPNFPVNYNNNHECIYSIQTQPGKGIQLKAKTFDLYEGDVLKSLEKKGKKNRNITTFFP
RDSNGGCLKAVNSSMSKLLKTAPGYSVKCFQSVLILKSQVWSELCAYLLAGCSLRTNGTY
SPTFLLFLVIGRYVSLCILPTTLQDCTSSFHFLTKKRENSPYFYMAIQMNLQIFWVVVVK
NSKNFFYKVCSLNERKHYQLLKEKHNSVDCNLALQYLTVSCGRKKIPSVFFSFTKHSITF
TLNLDMGFTSSSSIDCFIVSLCLYCNEFVFPKDRTTKRNFSEASKFLLWMCFPLLKLSGV
NKLICLYINYNLLFFSPAPCGGDLSGPSGVILSPNYPEPYPPGKECDWKVTVSPDYVIAL
VFNTFNLEPGYDFLHIYDGLDSHSPLIGSFYGSQLPERIESSSNSLFLAFRSDASVSNLG
FVIDYTENPRESCFDPGSIKNGTRTGTDLKLGSTVTYYCNGGYVIEGASTLTCILAADGK
PVWNKPRPICTAPCGGQYVGSDGVVLSPNYPQNYTRGQVCLYFIVVPKDYVVFGQFAFFH
TALNDVVEVHDGHTQHSRLLSSLSGSHTVGESLPLATSNQVLIKFSAKGQATARGFHFVY
QAVPRTSATQCSSVPEPRYGRRIGSDFSVGAVIRFECNSGYSLQGSRHIECLTVPGALAQ
WNVSVPICVVPCGGNLTERKGTILSPGFPEPYLNSLNCVWKITVPEGAGIQIQVISFVTE
QNWDSLEVFDGADNTVTMLGSFSGTTVPALLNSTSNHLYLHFYSDISVSAAGFHLEYKTV
GLSSCPEPTVPSNGMKIGERYLVNDVVSFQCEPGYALQGHSHISCMPGTVRRWNYPPPLC
IAQCGGTVEEMEGVILSPGFPGNYPSNMDCSWRITLPVGFGAHIQFLNFSSEPNHDFIEI
RNGPYETSHVIGKFSGNDLPGSLLSTSHETTVYFHSDHSQNRPGFKLEYQAYELQECPDP
EPFANGIVRGAGYNVGQSVTFECLPGYQLIGHPVLTCLHGTNRNWDHPLPRCEVPCGGNI
TLYNGTVYSPGFPNPYPNSQDCTWLFTVPPGHGIHFNFSLLQMEPDNDFITIWDGPQQTA
PQLGVFTRSSAKKITQSSSNQVLLKFHSDAAVGGIFVIAFSAYQLSKCPPPTILPNAEVI
TENEEFNIGDIVRYRCLPGFSLVGSEILTCKLGTHLQFEGPPPTCEVRCPMDELLTDSTG
VILSQSYPGSYPQFQTCSWVVRVEPGYNVSLTVEYFLSEKQYDEFEIFDGPSGQSPLLIA
LSGNYSAPLTVTSSGNNVYLRWSSDHAYNRKGFKIRYAAPYCSIPSPPLHGSILGQPSTH
PGGSIHFGCNAGYRLVGHSKAICSWHPQGYYMWNEAIPLCQALSCGIPKSPKNGIVFGKE
YTVGTKAVYSCNEGFRLHLPLNTEATAECLETGMWSNDNIPPQCVAVSCPDVSSISVEHG
RWRLTYETQYQFNAELMLICDPGYYYTGQRVIRCQADGKWSLGDSLPTCQIISCGDLPTP
PNGHRIGTLSVYGATAIFSCNSGYTLVGSRVRECMANGLWSSSEVRCLAGHCGTPELIVN
GQINGENYSYRGSVVYQCNPGFRLIGMSVRICQQDHRWSGKTPFCVPITCGHPGNPANGN
TQGSQFNLNDMVKFVCNEGYVAEGPSGAQCLANGQWSNALPVCRIINCTDPGHQENSIRH
IQSSGSHRFSFGTTVSYQCNHGYYLLGTHVLTCQGDGTWDRSLPQCLLVSCGHPGSPPHS
QISGDSYTVGSVVHYSCLGKRTLIGNATRMCQLDGHWSGSLPHCSGSNVGICGDPGIPPH
GIRLGDEFVIGSLMRFSCEPGYVLRGSSERTCRVNGSWSGTQPECEVLSCGNPGTPSNAR
VVFNDGLVFSSSIIYECREGYYATGLLSRHCSVNGTWTGSSPECTVINCGDPGIPANGIR
LGSDFTYNKTVTYQCVPGHMMEFDRASVLRCTKDRVWNGTKPVCKAILCKAPPPVPNGKI
VGSDFMWGSSVTYACLEGYQLSLPAVLTCEGNGSWSGELPQCFPVFCGDPGVPPYGRRED
RGFSYRSSVSYSCPPPLVLVGSSRRFCQSDGTWSGTQPSCIDPALTMCTDPGVPQFGMQN
NSQGYQVGSLVFYRCQKGYLLQGSTTRTCLPNLTWSGTPPDCVPHHCKQPETPTHANVGA
LDLPSMGYTLIYSCQSGFSLKGGSEHRTCKADGSWTGKPPICLEKSVSEINMNGARTPLV
PGDVFAKNSLWKGSYEYKGKRHPAILRVMGFQSATGKVNATLIDQDRVELHMSGIYKKED
FHLLLQVYHIMSPKDVSVSQFKDDNWALDGHVSSESSGGGTFVYQGFVRGQDFGHFGLQR
IDLSRLETDSESIGRHLASNSSSVAAAILVPFIGLIIAGFVLYLYKHRRRPKVPFNGYAG
HENTNVRATFENPMYDRNLQPTDIMAPEAEFTVSTVCTAV
Download sequence
Identical sequences G3VLH3
ENSSHAP00000004028 ENSSHAP00000004028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]