SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004175 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004175
Domain Number 1 Region: 512-638
Classification Level Classification E-value
Superfamily TIMP-like 1.61e-25
Family Tissue inhibitor of metalloproteinases, TIMP 0.037
Further Details:      
 
Domain Number 2 Region: 268-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000649
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 3 Region: 333-398
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000114
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 4 Region: 396-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000642
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 92-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000276
Family APC10-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004175   Gene: ENSSHAG00000003679   Transcript: ENSSHAT00000004216
Sequence length 638
Comment pep:novel scaffold:DEVIL7.0:GL841599.1:70864:126720:-1 gene:ENSSHAG00000003679 transcript:ENSSHAT00000004216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGLALILLLESAVSGSGEAGKFHTFRCDHHACNPPVGNLATGRIPITFTTCGESGTE
LSCFYVDQPALPSNTLNCGHLQCTKCNAQQPNNSHPPSSMTDNVFITPSTWWQSAPGISR
EEVRLDFETEFYLTHVIVVFKSPRPAAMILERSQDGGHTWRPYKYFATNCTATFGLQDDL
TEEGSLCTSRYSDAIPCTRGEVIYRALTPTNQIADPYGPEAQDLLKLTNLRLLLLKRQDC
PCQGMRLLEKPQRFTHYAIYDLIVRGSCFCNGHGEMCRPVDEMGDSRNKVHGACVCRHHT
AGLHCEKCLPLYNDQPWKPGDGKTNQPNECKKCRCHNHADSCHFDEDVWLSSGKRRGGIC
DNCRHHTEGRHCQKCKSGFYRDWSKPMSSPEVCKPCSCQPLGSSNETSHKGFPCHPKTGY
CLCKPGVAGPHCDRCLVGYWGFGGNGCRPCNCSGACDPHTGACLSGHEKEPFLHIPVGGQ
IPDLVQGPGNDSEEPEPLRWDGQEQGFSALRHPEKCVCKEKAVGKVRDFCQMKYAYVIKA
KILSAYDKGTHAEVWVKVKKVLKSGQMKISRSHQSIYPESWTHRGCTCPILNPGTDYLIA
GQEDPKNSKLLVNMNSLVKPWKVYLGKQVTGILRTGCK
Download sequence
Identical sequences G3VLX0
ENSSHAP00000004175 ENSSHAP00000004175 XP_003762523.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]