SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004360 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004360
Domain Number 1 Region: 81-223
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.91e-41
Family Regulator of G-protein signaling, RGS 0.000000148
Further Details:      
 
Domain Number 2 Region: 763-844
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.31e-27
Family DIX domain 0.0000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004360   Gene: ENSSHAG00000003838   Transcript: ENSSHAT00000004404
Sequence length 844
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841552.1:77076:262101:-1 gene:ENSSHAG00000003838 transcript:ENSSHAT00000004404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQSPKMNVQEQGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPVSHSFYFGKGDGIKNE
TSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDSADLL
DFWFACSGFRKLEPCDSNEEKRLKLAKAIYRKYILDSNGIVSRQTKPATKSFIKDCIMKQ
HIDPAMFDQAQTEVQSMMEDNTYPLFLKSDIYLEYTRTGLESPKIFSDQSPGSGTGKGIP
GYLPTLNEDEEWKCDQDTEEDHGRDSAPASRLTQKLLMETAPQRASSNRRYNESREFRHG
SWREPVNPYYVNSGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGVPPYRTRKQHRRE
MQESVKANGRVPLPHIPRTYRMPKEIRVEPQKFAAELINRLEAVQRTREAEEKLEERLKR
VRAEEEGEDANVSSGPSVVSHKLPSAQTLHHFPPRYGDMGCAGIRDVHEENPESILDEHV
QRVMKTPGCQSPGPGHHSPKPRSPDNGHAAKIPGTLGTGPPGHSKHSTKSGMKLDAANLY
HHKHVYHHIHHHSVMKPKEQIEAEATQRVQNSFAWNAESHNYATKSRNYNESMGLASNPV
DALGYSGKTSMLSKRNSKKADSGKSAGPNYEMPGSPEDVEKNQKIMQWIIEGEKEISRHK
KTNHGSSGTKKQSGHDSSRPLSIERPGAVHPWVSAQLRNVVQPSHLFIQDPTMPPNPAPN
PLTQLEEARRRLEEEEKRAGKLPTKQRAKLQKKLGNSSAPPCDTIVVAYYFCGEPIPYRT
LVKGRVVTLGQFKELLTKKGNYRYYFKKVSDEFDCGVVFEEVREDDAILPIFEEKIIGKV
EKVD
Download sequence
Identical sequences G3VMF5
ENSSHAP00000004360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]