SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004380 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004380
Domain Number 1 Region: 138-323
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-38
Family Laminin G-like module 0.0055
Further Details:      
 
Domain Number 2 Region: 531-542,578-740
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.16e-35
Family Laminin G-like module 0.0025
Further Details:      
 
Domain Number 3 Region: 5-166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-31
Family Laminin G-like module 0.0051
Further Details:      
 
Domain Number 4 Region: 380-438
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000335
Family Fibrinogen C-terminal domain-like 0.0046
Further Details:      
 
Domain Number 5 Region: 352-388
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000263
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004380   Gene: ENSSHAG00000003854   Transcript: ENSSHAT00000004424
Sequence length 807
Comment pep:known_by_projection scaffold:DEVIL7.0:GL849601.1:77683:435086:-1 gene:ENSSHAG00000003854 transcript:ENSSHAT00000004424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTFKDVISLKFKSMQGDGVLFHGEGQHGDYITLELQKEKLSLHVNLGDSKRRFTNSQPS
VTLGSLLDDQHWHSVLIERFNKQVNFTVDKHTQHFRAKGDGDYLDIDYELSFGGIPVPGK
PGTFLKKNFHGCIENLYYNGVNIIDLAKRRKHQIYTVGNVTFSCSEPQIVPITFVNSQSS
YLLLPGTPQIDGLSVSFQFRTWNRDGLLLSTTLSEDSGILLLYLEDGMLKLVIQKMTERS
MEISTGSNLNDGLWHSVSINARRNRITLTLDNDAASAAHETTRLQIYSGNSYYFGGCPDN
FTDSQCLNPIKAFQGCMRLIFIDNQPKDLISVQQGSLGNFSDLHIDLCSIKDRCLPNYCE
HGGMCTQSWATFYCNCSDTGYTGATCHNSIYEQSCEAYRHKGNTSGFFHIDSDGSGPLEP
LYVYCNITEDKIWTAVQHNNTELTRVRGAHPKRPYVMYFNYSSSMEQLEAMINSAEYCEQ
EAIYHCKKSRLLNTPNGIPFTWWIGRGNERHPYWGGSLPGVQQCACGLEESCVDMRHFCN
CDADKEEWTNDTGLLSFKDHLPVTQIVITDTNRSNSEAAWRIGPLRCYGDRHFWNAASFN
TEASYLHFPTFHAEFSADISLFFKTTALSGIFLENLGIKDFIRLEISSPSEVTFSIDVGN
GPMELTILSPSPLNDNQWHYVRAERNLKQTFLQVDDLPAKILETQEEGHFRLQLTSQLFV
GGTASRQKGFLGCIRSLRLNGQKLDLEEKAKVTAGVKPGCPGHCSSYGNFCHNGGKCVEK
YNGYLCDCTNSPYEGPFCKKGRLHSYC
Download sequence
Identical sequences G3VMH5
ENSSHAP00000004380 ENSSHAP00000004380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]