SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004405 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004405
Domain Number 1 Region: 19-61
Classification Level Classification E-value
Superfamily UBA-like 0.00000765
Family TAP-C domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004405   Gene: ENSSHAG00000003878   Transcript: ENSSHAT00000004451
Sequence length 226
Comment pep:known_by_projection scaffold:DEVIL7.0:GL857184.1:78509:157378:1 gene:ENSSHAG00000003878 transcript:ENSSHAT00000004451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVDLDPELMQKFSCLGTTDKDVLISEFQRLLGFQLNPAGCAFFLDMTNWNLQAAIGAYY
DFESPNISVPSMSFVEDVTIGEGESIPPDTQFTKTWRIQNSGAEAWPPGVCLKYVGGDQF
GHVNMVMVRSLEPQEIADVSVQMCSPSIAGMYQGQWRMCTATGLYYGGAEGSLHLKTIGT
EGPLFFNTSSLMLSSLTWWLLKRQYGDAWQAQISCCSVISVMLNFS
Download sequence
Identical sequences G3VMK0
ENSSHAP00000004405 ENSSHAP00000004405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]