SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004437 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004437
Domain Number 1 Region: 61-113
Classification Level Classification E-value
Superfamily EF-hand 0.0000000773
Family Calmodulin-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004437   Gene: ENSSHAG00000003903   Transcript: ENSSHAT00000004483
Sequence length 113
Comment pep:novel scaffold:DEVIL7.0:GL834612.1:79697:80169:1 gene:ENSSHAG00000003903 transcript:ENSSHAT00000004483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EREKEERIPEFAIKLLDQIISVFFSKVKFFGLIKTLVHFRLIKNKKKNKDVNLPPPLNSQ
NNKMYSAFLLYDLDKDDRSSRDELLQILCMMVGVNISEEQLGSIIDRMILKAD
Download sequence
Identical sequences G3VMN2
ENSSHAP00000004437 ENSSHAP00000004437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]