SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004477 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004477
Domain Number 1 Region: 413-519
Classification Level Classification E-value
Superfamily PDZ domain-like 2.66e-23
Family PDZ domain 0.0000364
Further Details:      
 
Domain Number 2 Region: 1160-1230
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.71e-17
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004477   Gene: ENSSHAG00000003936   Transcript: ENSSHAT00000004523
Sequence length 1272
Comment pep:known_by_projection scaffold:DEVIL7.0:GL862090.1:81064:128326:1 gene:ENSSHAG00000003936 transcript:ENSSHAT00000004523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKTEPTGERSTLRSASPHRNAYRTEFQALKSAFDKPKAEGDPKAKEGEGSQQSRGRKYG
SNVNRIKNLFMQMGMEPSESGAAPPKARPKGGPPSPPRLLEKADGCVLKLESSVSERISR
FDTLHDGPSYSKFSETRRMFERNSRRSPQSERPGAEAPDDWPAAKSNRGSTDSLDSLSSR
PEAVSPTVSQLSAVFENSDTLSENQEEDSGPGAEVPSPLKEPDSWGPPDPRGPEAAGEAP
DGPGRGAEEAATLHQERGPGKSAGPDDVAKAASEELPALQPPSAEPEAPKALGDRLVGDV
PGKEGVPEEGNAAQSSHVYMHTDYNVYRVRSRYNSDWGEAGTEPEDQEDSDENLDYQPSR
DYLEISGLPEEDDVPANRKIKFSRAPIKVFHTYSNEDYDRRNDDVDPVAASAEYELEKRV
EKLDLFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVTDGGAAQLDGRIQVNDQI
VEVDGISLVGVTQNFAATVLRNTKGTVRFVIGREKPGQVSEVAQLISQTLEQERRQRELL
EQHYGQCDADDDEVRGTGAGLRVPGLSNNSHYYKHWILKNTGEYATDEEDEEVGPSLPSR
DLAIEVFELPENEDVFSPSELDTGKLSHKFKELQIKHAVTEAEIQKLKNKVRRARSRRVP
HWGFTDLCQLLRMSVVHPKLLPAAALSRLHKRWLALRSLEPRTQSSSGRVAALELRDLHQ
MHLLQLLELLPLGFLPPDEVELSAEGKEDGEEETSGLGLQHGALSQIQELEAEVFRLMKQ
NGTQVNNNNNIFERSTGLADVPKGEAVGTPDTQQVSTQGLLGRDLNEAVPETERLDSKAQ
KTRAQLSVKNKRQRPSRSRLYDSVSSTDGEDSVERKPAPSHRSAAIEKAAPGKANRGPFS
ETQPGVPPTPPHIPSPFPPTPPHFPSLPLPLTSLPPPFPLFSLLSKWGSPEVGSEPCSLE
LEQERETRQSSGSSRSTALRATQGVASRGPQMGGCHWPEGMPKAWQLMAGERKAAGGSVS
EGITAGTKPDGSKSRDAVREPWGAGRQWGTYPFATSQEEPSRDGGKVSAGSVRRGALEGL
QAVLGRPEGRVRPLVLGAPRERNNFPLPDDFSPSSTSSADLSGLGPEPKVPGLSRSLALS
SDEILDEGQSPKHSQGQGRAVREWSVQQVAQWLRSLNLEQYVAEFSTQSVSGEQLLQLDG
SKLKALGVTSSQDRALIKKQLKDMKAALEKARKAQEKMEKQREKLRRKEQQQRKARRAEP
ASPEAPEGATEQ
Download sequence
Identical sequences G3VMS2
ENSSHAP00000004477 ENSSHAP00000004477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]