SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004512 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004512
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.71e-19
Family PHD domain 0.0000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004512   Gene: ENSSHAG00000003968   Transcript: ENSSHAT00000004558
Sequence length 118
Comment pep:novel scaffold:DEVIL7.0:GL867632.1:82297:84032:1 gene:ENSSHAG00000003968 transcript:ENSSHAT00000004558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSIPVYCLCQSPYDANHFMIECDLCQQWFHGSCVGVEEEKAIDIDVYHCPKCEILHGPS
IMKKCRRTQAQKLIGKKAAGKTGQTGSPEFTQERRQRRVINFRSMISTPNPARMNVNN
Download sequence
Identical sequences G3VMV7
ENSSHAP00000004512 ENSSHAP00000004512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]