SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004541 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004541
Domain Number 1 Region: 86-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000512
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 37-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000018
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004541   Gene: ENSSHAG00000003996   Transcript: ENSSHAT00000004589
Sequence length 698
Comment pep:novel scaffold:DEVIL7.0:GL841657.1:83728:119455:-1 gene:ENSSHAG00000003996 transcript:ENSSHAT00000004589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPQNAICVNKTHCACENGFVTTSGEKYFSDFLEICDDLNECLPPIKIHCGKNASCINTYG
GYYCGCNTGYSLPSGETKFPNPMDCQDINECETIFVCGQNANCVNTDGSFHCICTTGYAL
PSGENKFSDAVMNNCQAPALASPPAKDLRFFCRTHSLAQVFGFSFNPQDADKSENDIVWP
RYTKHKNTLGSPYQKVSEKNITGKNFSLEHGARHYFLAPALVKARFHFISLNYPDEKMLT
QKSFKKSVMTSPSPSKKLTNWMLRCLNNTSSPNVFLVSILDQQNINKLRSVVSLKAKDSN
QITPNFSLEKPGARVTIDSSVVTVFLETTQNANLSTPVIFTFQHNHMKNMKEKSLCVYWD
DTVWSNKGCKTISFNDSHTVCSCSHFSSFAVLMASVELKEDFVLTIITYVGLGLSLLCLF
LAALTFLLCRAIRGTGTLLHLQLSLCLFLANLLFLTGIERTEPKIMCSIIAGGLHYLYLA
AFTWMFLEGLHLFLTVRNLRVANYTSASRFKKRFMYPFGYGIPAVIVAVSAGIVPQGYGT
NHYCWLNLHRGFVWSFMGPVFIIILINLSFYFTTLWILRDRLSSLNKEVSTIQNTRTLTI
KALAQLFILGCSWSLGFFLIDSIAESIRLIIAYAFTIINSLQGVYIFLVHCVLNRQVQEE
YKKCFKRSKERTETDTYVLSSSTSHTRTRALSKHEIHL
Download sequence
Identical sequences G3VMY6
ENSSHAP00000004541 ENSSHAP00000004541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]