SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004549 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004549
Domain Number 1 Region: 2-155
Classification Level Classification E-value
Superfamily UBC-like 1.51e-50
Family UBC-related 0.000000183
Further Details:      
 
Domain Number 2 Region: 158-198
Classification Level Classification E-value
Superfamily UBA-like 1.3e-19
Family UBA domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004549   Gene: ENSSHAG00000004003   Transcript: ENSSHAT00000004597
Sequence length 200
Comment pep:novel scaffold:DEVIL7.0:GL867635.1:84012:84614:1 gene:ENSSHAG00000004003 transcript:ENSSHAT00000004597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEMLKSEETNKNQIKIDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFRPPKVRFITKVWHPNISSVTGAICLDILKDQWAATMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFQQTAQFWAHVYAGAPASSSEYAKKIENLCAMGFDRNAVI
VALSSKSWDVETAVELLLSN
Download sequence
Identical sequences G3VMZ4
XP_003775119.1.9362 ENSSHAP00000004549 ENSSHAP00000004549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]