SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004703 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004703
Domain Number 1 Region: 570-795
Classification Level Classification E-value
Superfamily vWA-like 1.85e-62
Family Integrin A (or I) domain 0.00039
Further Details:      
 
Domain Number 2 Region: 5-192
Classification Level Classification E-value
Superfamily vWA-like 2.09e-56
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 3 Region: 357-484
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.3e-17
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 4 Region: 197-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000991
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 482-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family EGF-type module 0.022
Further Details:      
 
Domain Number 6 Region: 526-566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000553
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004703   Gene: ENSSHAG00000004130   Transcript: ENSSHAT00000004751
Sequence length 918
Comment pep:known_by_projection scaffold:DEVIL7.0:GL841370.1:89956:166922:1 gene:ENSSHAG00000004130 transcript:ENSSHAT00000004751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPESSCENKQADLVFIIDSSRSVSPYDFAKVKEFIVTILQFLDIGPDVTRVGLIQYGSTV
KNEFSLKTFKRKSEVERAVKRMMHLSTGTMTGLAIQYAVNIAFSEAEGARPLRENVPRII
MIVTDGRPQDPVAEVAAKARNSGILIFAIGVGQVDYNTLKSIGSEPHEDHIFLVANFSQI
ETLTSVFQNKLCVAHMCNIMEHNCAHFCINTPGSYLCRCKQGYILNTDQKTCRKPNNSLV
AQEELDSEVLCLSFPGCNPHFLFIRTEYSHSAPAFVYLSLESYICHFSSINNRSSYDVQA
PKCFGKKDFKKLCKMVNYCSSMRESLHHGCWQNFIVNNGEEREEKTLFSLTLSQNKVQCR
GINYCAMRKHGCEHECANTEEGYYCRCRPGYTLNPNGKTCRRVDHCAENNHGCEQLCLNT
DDSYVCQCSEGFVINEDLKTCSRVDYCLLSDHGCEHSCINTDESFVCQCSEGYVLRSDGR
TCKRLDACALGDHDCEHTCVSLEDSYECRCYEGYTLRDDGKTCRVLDPCALGHHGCEHSC
VSRGESYMCICFEGYTLLQDGKTCKREDVCKSTNHGCEHTCVNDGNSYICKCSEGYVLAE
DGKRCRKCTEGPIDLVFVIDGSKSLGEENFEIVKHFVTGILESLEISPKAARVGLLQYST
QVRTEFTLRDFHTARDMKKAVTHMKYMGKGSMTGLALKQMFEKSFTEGEGARPLSARVPR
VAIVFTDGRAQDDVSEWANRAQRNGITIYAVGVGKAIEEELQEIASDPPDKHLFYAEDFS
TMGEISEKLKKGICKALEDSDGNQDFPEGDLSKMAQQPPEPEPITINIQDLLSCSNFAVH
HRYLFEDDSLSQSTQSLFHSTKTKGSPSEEKHDQCKCENLLTFQNFANQEVRKLTESNGL
LEEMTRRMEVLENRLRYR
Download sequence
Identical sequences G3VNE8
ENSSHAP00000004703 ENSSHAP00000004703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]