SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000004814 from Sarcophilus harrisii 76_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000004814
Domain Number 1 Region: 67-322
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-42
Family YWTD domain 0.000019
Further Details:      
 
Domain Number 2 Region: 943-1220
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-31
Family YWTD domain 0.0000899
Further Details:      
 
Domain Number 3 Region: 1-57,315-376
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.04e-18
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 807-849
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 644-681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 522-562
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 7 Region: 683-719
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 404-444
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 725-769
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 604-639
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 11 Region: 367-402
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 12 Region: 561-601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 13 Region: 487-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 446-483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 15 Region: 851-934
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000115
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 16 Region: 1438-1480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.04
Further Details:      
 
Domain Number 17 Region: 1304-1340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000081
Family EGF-type module 0.011
Further Details:      
 
Domain Number 18 Region: 1341-1375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000995
Family EGF-type module 0.026
Further Details:      
 
Domain Number 19 Region: 771-803
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000123
Family LDL receptor-like module 0.004
Further Details:      
 
Domain Number 20 Region: 1267-1303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000681
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000004814   Gene: ENSSHAG00000004225   Transcript: ENSSHAT00000004862
Sequence length 1652
Comment pep:novel scaffold:DEVIL7.0:GL849612.1:94891:456193:-1 gene:ENSSHAG00000004225 transcript:ENSSHAT00000004862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKCWPGFQLKDDGKTCMDMDECSSGFPCSQQCINTYGTYKCLCTEGYEIQPDNPNGCKSL
SDLDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYWIDSSRPNGS
RINRMYLNGSDIKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVSKLNGLYPTILVSKR
LKFPRDLSLDPRAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMALTIDYVNSRL
YWADENHIEFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLSRAHKTSGADR
LSLINSWHTITDIQVYHSYRQPDVAKHVCMLNNGGCSHLCLLAPGRTHTCACPTNFYLAA
DNKTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQPGRFQCGTGL
CALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPINLRCNGQDDCGDEEDE
RDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHEFQCKNNNC
IPDHWRCDSQNDCSDNSDEENCKPQTCTLKDFLCANGDCVSSRFWCDGDYDCADGSDERN
CETGCSKDQFQCATGQCISAKWKCDGHEDCKFGDDEKNCEPASPTCSSSEYICASGGCIS
ASLRCNGEYDCADGSDEMDCVTECKEDQFRCKNKAHCIPIRWLCDGVHDCVDGSDEDHCD
RGGNICRADEYLCNNSLCKLHFWVCDGEDDCGDNSDEVPEMCAKFPCPPTRPHRCRNNRV
CLRPEQICNEIDDCGDNSDEDHCGDKLTYKTRPCKKDEFACGDRKCIPMELQCDRFDDCG
DGSDEQGCRTVPSEYTCEDNVNPCGDDAYCNQTQTSVFCRCKPGFQRNMRNRQCEDLNEC
LVFGTCSHQCINMKGSYKCICDQNYKEKNNTCIAKSSEDQVLYISNDTDILGFIYPFNYS
GDHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRVHGRERRQTTSGLICPEF
KRPRDIAVDWIAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQLNGPNCTRLLTNMAGE
PYAIAVNPKRGMMYWTVVGDHSHIEEAAMDGTLRRILVQKNLQRPTGLAVDQFSQRIYWA
DFELSIIGSVLFDGSDSVISVSSKQGLLHPHRIDIFEDYIYGAGPKTGVFRVHKFGHSSV
EYLNLNVDKTKGALISHRYKQQDLPNPCLDLTCEFLCLLNPFGATCVCPEGKSLINGTCN
DESLLDDSCKLTCENGGRCIVNEKGDLRCHCWPSYSGERCEINHCTNYCQNGGTCVASAL
GRPTCSCALGFTGPNCNQMVCEKFCQNGGSCSVTAGNQPYCQCMPEYTGDRCQYYVCHHY
CVNSESCTIADDGNVECVCPTRYEGTKCEVDKCLRCHGGHCIINKDSEDITCNCTNGKIA
SSCQLCDGYCYNGGTCQLDPETNIPVCLCSANWSGTQCERPAPKSSKSDHISTRSIAIIV
PLVLLVTLITTLVIGLLLCKRKRRTKTIRRQPIINGGINVEIGNPSYNMYEVDHDHNDGS
LLDPDFIVDSAKVTSFSLEENKMRAPHRGLPKIFHNSLKKNETSVAPTNYSNPVYAKLYM
DGQNCRNSLGSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences G3VNQ9
ENSSHAP00000004814 ENSSHAP00000004814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]